RASSF6 Antibody

Images

 
Western Blot: RASSF6 Antibody [NBP2-55145] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: RASSF6 Antibody [NBP2-55145] - Staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemistry-Paraffin: RASSF6 Antibody [NBP2-55145] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RASSF6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SDLPYRISSDHLKKEEKMTMMAHQYPSWIFINEKTFITREQLNSLLKTYNIFYENQKNLHILYGETEDGKLIVEGMLDIFWGVKRPIQ
Specificity
Specificity of human RASSF6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASSF6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RASSF6 Recombinant Protein Antigen (NBP2-55145PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RASSF6 Antibody

  • DKFZp686K23225
  • putative RAS binding protein
  • Ras association (RalGDS/AF-6) domain family 6
  • Ras association (RalGDS/AF-6) domain family member 6
  • ras association domain-containing protein 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-248
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89425
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89249
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20163
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5639
Species: Hu, Mu
Applications: WB, ICC
NBP1-48017
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
H00060485-M02
Species: Hu, Mu, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-41130
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-31233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-93790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-45745
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IF
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-88128
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RASSF6 Antibody (NBP2-55145) (0)

There are no publications for RASSF6 Antibody (NBP2-55145).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASSF6 Antibody (NBP2-55145) (0)

There are no reviews for RASSF6 Antibody (NBP2-55145). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RASSF6 Antibody (NBP2-55145) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RASSF6 Products

Bioinformatics Tool for RASSF6 Antibody (NBP2-55145)

Discover related pathways, diseases and genes to RASSF6 Antibody (NBP2-55145). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASSF6 Antibody (NBP2-55145)

Discover more about diseases related to RASSF6 Antibody (NBP2-55145).
 

Pathways for RASSF6 Antibody (NBP2-55145)

View related products by pathway.

PTMs for RASSF6 Antibody (NBP2-55145)

Learn more about PTMs related to RASSF6 Antibody (NBP2-55145).

Blogs on RASSF6

There are no specific blogs for RASSF6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RASSF6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASSF6