RASSF4 Antibody

Images

 
Western Blot: RASSF4 Antibody [NBP1-89249] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: RASSF4 Antibody [NBP1-89249] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus, nucleoli & cell junctions.
Immunohistochemistry-Paraffin: RASSF4 Antibody [NBP1-89249] - Staining of human testis shows strong nuclear positivity in seminiferus tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RASSF4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QDDREQVHLPSTSWMPRRPSCPLKEPSPQNGNITAQGPSIQPVHKAESSTDSSGPLEEAEEAPQLMRTKSDASCMSQRRPKCRAPGEAQRI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASSF4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RASSF4 Protein (NBP1-89249PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RASSF4 Antibody

  • AD037
  • MGC44914
  • Ras association (RalGDS/AF-6) domain family 4
  • Ras association (RalGDS/AF-6) domain family member 4
  • Ras association domain family 4
  • ras association domain-containing protein 4
  • tumor suppressor RASSF4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-248
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89425
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5639
Species: Hu, Mu
Applications: WB, ICC
NBP2-55145
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP2-58860
Species: Hu
Applications: ICC/IF
NBP1-89958
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34980
Species: Hu
NBP1-92275
Species: Hu
Applications: IHC, IHC-P
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91348
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-49512
Species: Hu
Applications: IHC
NBP2-37262
Species: Hu, Rt
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready

Publications for RASSF4 Antibody (NBP1-89249) (0)

There are no publications for RASSF4 Antibody (NBP1-89249).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASSF4 Antibody (NBP1-89249) (0)

There are no reviews for RASSF4 Antibody (NBP1-89249). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RASSF4 Antibody (NBP1-89249) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RASSF4 Products

Bioinformatics Tool for RASSF4 Antibody (NBP1-89249)

Discover related pathways, diseases and genes to RASSF4 Antibody (NBP1-89249). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASSF4 Antibody (NBP1-89249)

Discover more about diseases related to RASSF4 Antibody (NBP1-89249).
 

Pathways for RASSF4 Antibody (NBP1-89249)

View related products by pathway.

PTMs for RASSF4 Antibody (NBP1-89249)

Learn more about PTMs related to RASSF4 Antibody (NBP1-89249).

Blogs on RASSF4

There are no specific blogs for RASSF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RASSF4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASSF4