RASSF1 Antibody


Western Blot: RASSF1 Antibody [NBP1-89411] - Analysis in control (vector only transfected HEK293T lysate) and RASSF1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: RASSF1 Antibody [NBP1-89411] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: RASSF1 Antibody [NBP1-89411] - Staining of human small intestine shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

RASSF1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:KFTCHYRCRALVCLDCCGPRDLGWEPAVERDTNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDG
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RASSF1 Protein (NBP1-89411PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RASSF1 Antibody

  • 123F2
  • NORE2A
  • pancreas-specific ras association domain family 1 protein
  • Ras association (RalGDS/AF-6) domain family member 1
  • ras association domain-containing protein 1
  • RDA32cardiac-specific ras association domain family 1 protein
  • REH3P21
  • tumor suppressor protein RDA32
  • WUGSC:H_LUCA12.5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RASSF1 Antibody (NBP1-89411) (0)

There are no publications for RASSF1 Antibody (NBP1-89411).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASSF1 Antibody (NBP1-89411) (0)

There are no reviews for RASSF1 Antibody (NBP1-89411). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RASSF1 Antibody (NBP1-89411) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RASSF1 Products

Bioinformatics Tool for RASSF1 Antibody (NBP1-89411)

Discover related pathways, diseases and genes to RASSF1 Antibody (NBP1-89411). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASSF1 Antibody (NBP1-89411)

Discover more about diseases related to RASSF1 Antibody (NBP1-89411).

Pathways for RASSF1 Antibody (NBP1-89411)

View related products by pathway.

PTMs for RASSF1 Antibody (NBP1-89411)

Learn more about PTMs related to RASSF1 Antibody (NBP1-89411).

Research Areas for RASSF1 Antibody (NBP1-89411)

Find related products by research area.

Blogs on RASSF1.

The role of DNMT3B in the co-incidence of methyltransferase and tumor suppressor expression in malignancies
Epigenetics is the process of heritable change in gene activity despite alteration of the hosts DNA sequence, essentially causing a change in a phenotype without a change in the genotype of a host. To change the gene sequence without interfering w...  Read full blog post.

Role of RASSF1A in Death Receptor-Dependent Apoptosis
Death-receptor apoptosis, or cell death, is essential for cellular growth regulation; its disruption is expressed in a variety of cancers. We at Novus Biologicals are one of the leading antibody suppliersfor apoptosis and cancer research groups, and t...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RASSF1 Antibody and receive a gift card or discount.


Gene Symbol RASSF1