Rasgrp1 Antibody - BSA Free

Western Blot: Rasgrp1 Antibody [NBP2-85605] - Host: Rabbit. Target Name: RASGRP1. Sample Tissue: Human HepG2 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Rasgrp1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Rasgrp1 Antibody - BSA Free (NBP2-85605) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Rasgrp1. Peptide sequence: GLCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTD The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RASGRP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Rasgrp1 Antibody - BSA Free

• RAS guanyl-releasing protein 1
• CALDAG-GEFI
• CALDAG-GEFII
• hRasGRP1
• RAS guanyl releasing protein 1 (calcium and DAG-regulated)
• RASGRP

Background

The Rasgrp1 gene is a member of a family of genes characterized by the presence of a Ras superfamily guanine nucleotide exchange factor (GEF) domain. It functions as a diacylglycerol (DAG)-regulated nucleotide exchange factor specifically activating Ras through

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RASGRP1