Rasgrp1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Rasgrp1 Antibody [NBP2-68636] - Staining of human cell line CACO-2 shows localization to plasma membrane & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Rasgrp1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASGRP1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Reactivity Notes

Mouse 85%, Rat 82%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Rasgrp1 Antibody

  • RAS guanyl-releasing protein 1
  • CALDAG-GEFI
  • CALDAG-GEFII
  • hRasGRP1
  • RAS guanyl releasing protein 1 (calcium and DAG-regulated)
  • RASGRP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
AF6260
Species: Hu
Applications: WB
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-45528
Species: Hu
Applications: WB, IHC
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-33315
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-75641
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-68636
Species: Hu
Applications: ICC/IF

Publications for Rasgrp1 Antibody (NBP2-68636) (0)

There are no publications for Rasgrp1 Antibody (NBP2-68636).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rasgrp1 Antibody (NBP2-68636) (0)

There are no reviews for Rasgrp1 Antibody (NBP2-68636). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Rasgrp1 Antibody (NBP2-68636) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Rasgrp1 Antibody (NBP2-68636)

Discover related pathways, diseases and genes to Rasgrp1 Antibody (NBP2-68636). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rasgrp1 Antibody (NBP2-68636)

Discover more about diseases related to Rasgrp1 Antibody (NBP2-68636).
 

Pathways for Rasgrp1 Antibody (NBP2-68636)

View related products by pathway.

PTMs for Rasgrp1 Antibody (NBP2-68636)

Learn more about PTMs related to Rasgrp1 Antibody (NBP2-68636).
 

Research Areas for Rasgrp1 Antibody (NBP2-68636)

Find related products by research area.

Blogs on Rasgrp1

There are no specific blogs for Rasgrp1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rasgrp1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASGRP1