RAP1GDS1 Antibody - BSA Free

Staining of human cell line A-431 shows positivity in cytoplasm.

Analysis in human cell line MOLT-4.

Staining of human cerebellum shows strong cytoplasmic positivity in cells in molecular layer.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil and neurons.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RAP1GDS1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RAP1GDS1 Antibody - BSA Free (NBP1-87027) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-RAP1GDS1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ESSKQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVECLLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGA
• Predicted Species: Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAP1GDS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RAP1GDS1 Protein (NBP1-87027PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RAP1GDS1 Antibody - BSA Free

• Exchange factor smgGDS
• GDS1
• MGC118859
• MGC118861
• rap1 GTPase-GDP dissociation stimulator 1
• RAP1, GTP-GDP dissociation stimulator 1
• SMG GDS protein
• SMG P21 stimulatory GDP/GTP exchange protein
• SmgGDS

Background

Stimulates GDP/GTP exchange reaction of a group of small GTP-binding proteins (G proteins) including Rap1a/Rap1b, RhoA, RhoB and KRas, by stimulating the dissociation of GDP from and the subsequent binding of GTP to each small G protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAP1GDS1 Antibody (NBP1-87027)(2)

Publications using NBP1-87027

• Kirsti Hornigold, Martin J. Baker, Polly A. Machin, Stephen A. Chetwynd, Anna-Karin Johnsson, Chiara Pantarelli, Priota Islam, Melanie Stammers, Laraine Crossland, David Oxley, Hanneke Okkenhaug, Simon Walker, Rachael Walker, Anne Segonds-Pichon, Yoshinori Fukui, Angeliki Malliri, Heidi C. E. Welch The Rac-GEF Tiam1 controls integrin-dependent neutrophil responses Frontiers in Immunology 2023-11-21 [PMID: 38077328]
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: RAP1GDS1