RAP1GDS1 Antibody


Western Blot: RAP1GDS1 Antibody [NBP1-69099] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: RAP1GDS1 Antibody [NBP1-69099] - Human lacenta Lysate 1ug/ml Gel Concentration 12%
Western Blot: RAP1GDS1 Antibody [NBP1-69099] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Western Blot: RAP1GDS1 Antibody [NBP1-69099] - Human Jurkat, Antibody Dilution: 1.0 ug/ml RAP1GDS1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

RAP1GDS1 Antibody Summary

Synthetic peptides corresponding to RAP1GDS1 (RAP1, GTP-GDP dissociation stimulator 1) The peptide sequence was selected from the middle region of RAP1GDS1. Peptide sequence LLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RAP1GDS1 and was validated on Western blot.
Theoretical MW
61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RAP1GDS1 Antibody

  • Exchange factor smgGDS
  • GDS1
  • MGC118859
  • MGC118861
  • rap1 GTPase-GDP dissociation stimulator 1
  • RAP1, GTP-GDP dissociation stimulator 1
  • SMG GDS protein
  • SMG P21 stimulatory GDP/GTP exchange protein
  • SmgGDS


The smg GDP dissociation stimulator (smgGDS) protein is a stimulatory GDP/GTP exchange protein with GTPase activity (Riess et al., 1993 [PubMed 8262526]).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, Flow, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB

Publications for RAP1GDS1 Antibody (NBP1-69099) (0)

There are no publications for RAP1GDS1 Antibody (NBP1-69099).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAP1GDS1 Antibody (NBP1-69099) (0)

There are no reviews for RAP1GDS1 Antibody (NBP1-69099). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAP1GDS1 Antibody (NBP1-69099) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RAP1GDS1 Products

Bioinformatics Tool for RAP1GDS1 Antibody (NBP1-69099)

Discover related pathways, diseases and genes to RAP1GDS1 Antibody (NBP1-69099). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAP1GDS1 Antibody (NBP1-69099)

Discover more about diseases related to RAP1GDS1 Antibody (NBP1-69099).

Pathways for RAP1GDS1 Antibody (NBP1-69099)

View related products by pathway.

PTMs for RAP1GDS1 Antibody (NBP1-69099)

Learn more about PTMs related to RAP1GDS1 Antibody (NBP1-69099).

Blogs on RAP1GDS1

There are no specific blogs for RAP1GDS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RAP1GDS1 Antibody and receive a gift card or discount.


Gene Symbol RAP1GDS1