![Western Blot: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Western blot analysis of extracts of various cell lines, using Rap1A/B Rabbit mAb (NBP3-16868) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/Rap1A-B-Antibody-6C7G0-Western-Blot-NBP3-16868-img0004.jpg "Western Blot: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Western blot analysis of extracts of various cell lines, using Rap1A/B Rabbit mAb (NBP3-16868) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clone | 6C7G0 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 70-150 of human Rap1A/B (P61224). LYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKS |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | RAP1A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RAP1A |
![Immunocytochemistry/Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Immunofluorescence analysis of U-2 OS cells using Rap1A/B Rabbit mAb (NBP3-16868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Rap1A-B-Antibody-6C7G0-Immunocytochemistry-Immunofluorescence-NBP3-16868-img0003.jpg "Immunocytochemistry/Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Immunofluorescence analysis of U-2 OS cells using Rap1A/B Rabbit mAb (NBP3-16868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Immunofluorescence analysis of C6 cells using Rap1A/B Rabbit mAb (NBP3-16868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Rap1A-B-Antibody-6C7G0-Immunocytochemistry-Immunofluorescence-NBP3-16868-img0001.jpg "Immunocytochemistry/Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Immunofluorescence analysis of C6 cells using Rap1A/B Rabbit mAb (NBP3-16868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Immunofluorescence analysis of NIH-3T3 cells using Rap1A/B Rabbit mAb (NBP3-16868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Rap1A-B-Antibody-6C7G0-Immunocytochemistry-Immunofluorescence-NBP3-16868-img0002.jpg "Immunocytochemistry/Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Immunofluorescence analysis of NIH-3T3 cells using Rap1A/B Rabbit mAb (NBP3-16868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Immunofluorescence analysis of NIH-3T3 cells using Rap1A/B Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16868_rabbit-rap1a-b-mab-6c7g0-5220251215466.jpg%3Ft=1688173697 "Immunocytochemistry/ Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Immunofluorescence analysis of NIH-3T3 cells using Rap1A/B Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Western Blot Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/Raf-1_MAB4540_Western_Blot_9426.jpg)
![Immunohistochemistry Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/Raf-1_MAB4540_Immunohistochemistry_9891.jpg)
![Simple Western Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/mab4540_human-mouse-rat-raf-1-mab-clone-563002-simple-western-158202212919.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")