RANBP9 Recombinant Protein Antigen

Images

 
There are currently no images for RANBP9 Recombinant Protein Antigen (NBP3-21406PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RANBP9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RANBP9

Source: E.coli

Amino Acid Sequence: ELNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTVMEVDSS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RANBP9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21406. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RANBP9 Recombinant Protein Antigen

  • BPM90
  • BPM-L
  • RAN binding protein 9
  • Ran Binding Protein in the Microtubule organizing center
  • ran binding protein, centrosomal
  • ran-binding protein 9
  • Ran-binding protein M
  • RanBP7
  • RanBP9
  • RanBPM
  • RANBPMnovel centrosomal protein RanBPM

Background

Just as heat shock proteins function as chaperones for exposed hydrophobic patches, importins act as chaperones for exposed basic domains, and it is suggested that this represents a major and general cellular function of importins (1). RanBP9, a novel interacting protein, was localized within the centrosome throughout the cell cycle. Overexpression of RanBP9 produced multiple spots which were colocalized with gamma-tubulin and acted as ectopic microtubule nucleation sites, resulting in a reorganization of microtubule network (2). It has been shown that RanBP9 can induce GTP-Ras association and Erk phosphorylation and elevate serum response element-luciferase (SRE-LUC) expression, indicating that RanBP9 can activate the Ras-Erk-SRE pathway. Also RanBP9 stimulates Ras activation by recruiting Sos (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
294-HG
Species: Hu
Applications: BA
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP3-46991
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-77372
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-49118
Species: Hu
Applications: IHC,  IHC-P
DBD00
Species: Hu
Applications: ELISA
NB110-68800
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
H00008731-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP1-33560
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
M6000B
Species: Mu
Applications: ELISA
MAB931
Species: Hu, Mu
Applications: CyTOF-ready, IHC, ICFlow, WB
AF276
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, Simple Western, WB
NBP1-90091
Species: Hu, Mu
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P
NBP1-33464
Species: Hu, Mu
Applications: ICC/IF, WB
NB300-543
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for RANBP9 Recombinant Protein Antigen (NBP3-21406PEP) (0)

There are no publications for RANBP9 Recombinant Protein Antigen (NBP3-21406PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RANBP9 Recombinant Protein Antigen (NBP3-21406PEP) (0)

There are no reviews for RANBP9 Recombinant Protein Antigen (NBP3-21406PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RANBP9 Recombinant Protein Antigen (NBP3-21406PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RANBP9 Products

Array NBP3-21406PEP

Research Areas for RANBP9 Recombinant Protein Antigen (NBP3-21406PEP)

Find related products by research area.

Blogs on RANBP9.

CD68 (Cluster of differentiation 68, GP110, LAMP4, SCARD1)
CD68 belongs to a growing family of hematopoietic mucin-like molecules known as lysosomal/endosomal-associated membrane glycoproteins (LAMPs). Other LAMP family members included leukosialin, stem cell antigen CD34, and GlyCAM-1. CD68 encodes a 110-kD ...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RANBP9 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RANBP9