RALGAPB Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RALGAPB Antibody [NBP2-14738] - Staining of human cell line CACO-2 shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RALGAPB Antibody [NBP2-14738] - Staining of human urinary bladder shows weak to moderate cytoplasmic and membranous positivity in urothelial cells.
Immunohistochemistry-Paraffin: RALGAPB Antibody [NBP2-14738] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: RALGAPB Antibody [NBP2-14738] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: RALGAPB Antibody [NBP2-14738] - Staining of human skeletal muscle shows very weak cytoplasmic and nuclear positivity in myocytes.
Immunohistochemistry-Paraffin: RALGAPB Antibody [NBP2-14738] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RALGAPB Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: LPCRPFDTVFIFYMKPGQKTNQEILKNVESSRTVQPHFLEFLLSLGWSVDVGRHPGWTGHVSTSWSINCCDDGEGSQQEVISSEDIGASIFNGQKKVLYYADAL
Predicted Species
Mouse (91%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RALGAPB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RALGAPB Protein (NBP2-14738PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RALGAPB Antibody

  • dJ1100H13.1
  • KIAA1219
  • RALGAPB Ral GTPase activating protein, beta subunit (non-catalytic)
  • RalGAPbeta
  • RP5-1100H13.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-18891
Species: Hu, Mu
Applications: IP, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-74648
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47256
Species: Hu, Mu
Applications: ICC/IF, IP, WB
AF4385
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
6507-IL/CF
Species: Hu
Applications: BA
236-EG
Species: Hu
Applications: BA
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
1129-ER
Species: Hu
Applications: BA
294-HG
Species: Hu
Applications: BA
NBP2-14738
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC

Publications for RALGAPB Antibody (NBP2-14738) (0)

There are no publications for RALGAPB Antibody (NBP2-14738).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RALGAPB Antibody (NBP2-14738) (0)

There are no reviews for RALGAPB Antibody (NBP2-14738). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RALGAPB Antibody (NBP2-14738) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RALGAPB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RALGAPB