RALBP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RALBP1 Antibody [NBP2-30698] - Staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry: RALBP1 Antibody [NBP2-30698] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RALBP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VQELFGNVVLKQVMKPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVINILLAQENEILTE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RALBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RALBP1 Protein (NBP2-30698PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RALBP1 Antibody

  • Dinitrophenyl S-glutathione ATPase
  • ralA binding protein 1
  • ralA-binding protein 1,76 kDa Ral-interacting protein
  • RalBP1
  • Ral-interacting protein 1
  • RIP
  • RIP1
  • RLIP1
  • RLIP76DNP-SG ATPase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF3204
Species: Hu, Mu, Rt
Applications: WB
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP1-77020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Other, Pm, Rb
Applications: WB, Flow
NBP1-81706
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30698
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for RALBP1 Antibody (NBP2-30698) (0)

There are no publications for RALBP1 Antibody (NBP2-30698).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RALBP1 Antibody (NBP2-30698) (0)

There are no reviews for RALBP1 Antibody (NBP2-30698). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RALBP1 Antibody (NBP2-30698) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RALBP1 Products

Bioinformatics Tool for RALBP1 Antibody (NBP2-30698)

Discover related pathways, diseases and genes to RALBP1 Antibody (NBP2-30698). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RALBP1 Antibody (NBP2-30698)

Discover more about diseases related to RALBP1 Antibody (NBP2-30698).
 

Pathways for RALBP1 Antibody (NBP2-30698)

View related products by pathway.

PTMs for RALBP1 Antibody (NBP2-30698)

Learn more about PTMs related to RALBP1 Antibody (NBP2-30698).

Blogs on RALBP1

There are no specific blogs for RALBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RALBP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RALBP1
Uniprot