RAI14 Antibody

Images

 
Western Blot: RAI14 Antibody [NBP1-94075] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: RAI14 Antibody [NBP1-94075] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.
Orthogonal Strategies: Western Blot: RAI14 Antibody [NBP1-94075] - Analysis in human cell lines U2OS and MCF-7 using anti-RAI14 antibody. Corresponding RAI14 RNA-seq data are presented for the same cell lines. ...read more
Independent Antibodies: Western Blot: RAI14 Antibody [NBP1-94075] - Analysis using Anti-RAI14 antibody NBP1-94075 (A) shows similar pattern to independent antibody NBP1-94076 (B).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAI14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ISPTQLSDVSSPRSITSTPLSGKESVFFAEPPFKAEISSIRENKDRLSDSTTGADSLLDISSEADQQDLLSLLQAKVASLTLHNKELQDK
Predicted Species
Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAI14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RAI14 Protein (NBP1-94075PEP)
Publications
Read Publication using
NBP1-94075 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAI14 Antibody

  • retinoic acid induced 14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82456
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
314-BP/CF
Species: Hu
Applications: BA, BA
AF5928
Species: Hu
Applications: ICC, IHC, WB
NB100-477
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00827
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87511
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02136
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF4377
Species: Hu, Mu
Applications: ICC, Simple Western, WB
NBP1-82486
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-16599
Species: Hu, Mu, Rt
Applications: WB
NB100-790
Species: Ba, Hu, Mu, Po
Applications: Flow, IF, IHC, IHC-P, IP, PEP-ELISA, WB
NBP1-83126
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-97491
Species: Bv, Ca, Ch, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
MAB2337
Species: Hu
Applications: IP, WB
NBP2-03367
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-83215
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-49409
Species: Hu
Applications: IHC, IHC-P
NB100-2688
Species: Hu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
NBP1-94075
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for RAI14 Antibody (NBP1-94075)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for RAI14 Antibody (NBP1-94075) (0)

There are no reviews for RAI14 Antibody (NBP1-94075). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAI14 Antibody (NBP1-94075) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAI14 Products

Array NBP1-94075

Bioinformatics Tool for RAI14 Antibody (NBP1-94075)

Discover related pathways, diseases and genes to RAI14 Antibody (NBP1-94075). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAI14 Antibody (NBP1-94075)

Discover more about diseases related to RAI14 Antibody (NBP1-94075).
 

Pathways for RAI14 Antibody (NBP1-94075)

View related products by pathway.

Blogs on RAI14

There are no specific blogs for RAI14, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAI14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAI14