IGBP1 Antibody

Western Blot: IGBP1 Antibody [NBP1-83126] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18, Lane 2: Human cell line RT-4, Lane 3: Human cell line EFO-21, Lane 4: Human cell line A-431

Immunocytochemistry/Immunofluorescence: IGBP1 Antibody [NBP1-83126] - Immunofluorescent staining of human cell line U-2 OS shows localization to microtubules.

Immunohistochemistry-Paraffin: IGBP1 Antibody [NBP1-83126] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: IGBP1 Antibody [NBP1-83126] - Staining of human Fallopian tube shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: IGBP1 Antibody [NBP1-83126] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: IGBP1 Antibody [NBP1-83126] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

IGBP1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSAVESGQADDERVREYYLLHLQRWIDISLEEIESIDQEIKILRERDSSREASTSNSSRQERPPVKPFILTRNMAQAKVFGAGYPSLP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IGBP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  IGBP1 Protein (NBP1-83126PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (83%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IGBP1 Antibody

• ALPHA-4
• B cell signal transduction molecule alpha 4
• bA351K23.1 (immunoglobulin binding protein 1 (CD79A) )
• B-cell signal transduction molecule alpha 4
• CD79a-binding protein 1
• IBP1
• immunoglobulin (CD79A) binding protein 1
• immunoglobulin-binding protein 1
• Protein alpha-4
• protein phosphatase 2A, regulatory subunit alpha-4
• Renal carcinoma antigen NY-REN-16

Background

The proliferation and differentiation of B cells is dependent upon a B-cell antigen receptor (BCR) complex. Binding of antigens to specific B-cell receptors results in a tyrosine phosphorylation reaction through the BCR complex and leads to multiple signal transduction pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IGBP1 Antibody (NBP1-83126)(1)

Publication using NBP1-83126

• Chen W, Pilling D, Gomer RH The mRNA binding protein DDX3 mediates TGF-?1 upregulation of translation and promotes pulmonary fibrosis JCI insight 2023-02-23 [PMID: 36821384] (IHC-Fr, WB, Mouse, Human)

Bioinformatics

• Gene Symbol: IGBP1