IGBP1 Antibody

Images

 
Western Blot: IGBP1 Antibody [NBP1-83126] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18, Lane 2: Human cell line RT-4, Lane 3: Human cell line EFO-21, Lane 4: Human cell line A-431
Immunocytochemistry/ Immunofluorescence: IGBP1 Antibody [NBP1-83126] - Immunofluorescent staining of human cell line U-2 OS shows localization to microtubules.
Immunohistochemistry-Paraffin: IGBP1 Antibody [NBP1-83126] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IGBP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSAVESGQADDERVREYYLLHLQRWIDISLEEIESIDQEIKILRERDSSREASTSNSSRQERPPVKPFILTRNMAQAKVFGAGYPSLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IGBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IGBP1 Protein (NBP1-83126PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (83%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IGBP1 Antibody

  • ALPHA-4
  • B cell signal transduction molecule alpha 4
  • bA351K23.1 (immunoglobulin binding protein 1 (CD79A) )
  • B-cell signal transduction molecule alpha 4
  • CD79a-binding protein 1
  • IBP1
  • immunoglobulin (CD79A) binding protein 1
  • immunoglobulin-binding protein 1
  • Protein alpha-4
  • protein phosphatase 2A, regulatory subunit alpha-4
  • Renal carcinoma antigen NY-REN-16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
AF993
Species: Mu
Applications: WB, IHC
NB100-2883
Species: Hu, Mu
Applications: WB, IP
MAB5074
Species: Hu
Applications: WB
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NBP1-80898
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IGBP1 Antibody (NBP1-83126) (0)

There are no publications for IGBP1 Antibody (NBP1-83126).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGBP1 Antibody (NBP1-83126) (0)

There are no reviews for IGBP1 Antibody (NBP1-83126). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IGBP1 Antibody (NBP1-83126) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGBP1 Products

Bioinformatics Tool for IGBP1 Antibody (NBP1-83126)

Discover related pathways, diseases and genes to IGBP1 Antibody (NBP1-83126). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGBP1 Antibody (NBP1-83126)

Discover more about diseases related to IGBP1 Antibody (NBP1-83126).
 

Pathways for IGBP1 Antibody (NBP1-83126)

View related products by pathway.

PTMs for IGBP1 Antibody (NBP1-83126)

Learn more about PTMs related to IGBP1 Antibody (NBP1-83126).
 

Research Areas for IGBP1 Antibody (NBP1-83126)

Find related products by research area.

Blogs on IGBP1

There are no specific blogs for IGBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGBP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IGBP1