RAD54L2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RAD54L2 Antibody [NBP2-58602] - Staining of human cell line U-2 OS shows localization to nucleus.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RAD54L2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RAD54L2 Antibody - BSA Free (NBP2-58602) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EHGYPVSGGFAMPPVSLNHNLTTPFTSQAGENSLFMGSTPSYYQLSNLLADARLVFPVTTDPLVPAGPVSSSSTATSVTASNPSFMLNPSVPGIL
• Predicted Species: Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAD54L2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RAD54L2 Recombinant Protein Antigen (NBP2-58602PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RAD54L2 Antibody - BSA Free

• Androgen receptor-interacting protein 4
• ARIP4
• EC 3.6.1
• EC 3.6.4.12
• FLJ21396
• FLJ22400
• helicase ARIP4
• KIAA0809HSPC325
• RAD54-like 2 (S. cerevisiae)
• RAD54-like protein 2
• SRISNF2L

Background

ARIP4 (androgen-interacting protein 4) was identified in a yeast two-hybrid screen using the human androgen receptor (AR) as bait. It was found to be a member of the SNF2 (sucrose nonfermenting 2) protein family and to have ATPase activity. ARIP4 is able to activate AR-dependent transcription. Targeted inactivation of ARIP4 results in embryonic lethality and reduced growth potential of embryonic fibroblast. These findings indicate an important role in development and proliferation. Alternate names for ARIP4 include RAD54-like protein 2, RAD54L2, and KIAA0809.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAD54L2