Rad51L1 Recombinant Protein Antigen

Images

 
There are currently no images for Rad51L1 Recombinant Protein Antigen (NBP2-55046PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Rad51L1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Rad51L1.

Source: E. coli

Amino Acid Sequence: SIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RAD51B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55046.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Rad51L1 Recombinant Protein Antigen

  • DNA repair protein RAD51 homolog 2
  • MGC34245
  • R51H2REC2hREC2
  • RAD51 (S. cerevisiae)-like 1
  • RAD51 homolog B
  • RAD51B
  • RAD51-like 1 (S. cerevisiae)
  • RAD51-like protein 1
  • RecA-like protein
  • recombination repair protein

Background

The Rad51 DNA repair protein is a key component of the double-strand break repair pathway and is essential for mitotic and meiotic recombination and genomic stability. Five human RAD51 homologues have been identified: XRCC2, XRCC3, RAD51B, RAD51C, and RAD51D. Each of these homologues interacts with one or more of the others, with all of the proteins involved with one complex or with multiple smaller complexes. Rad51B plays a role in meiotic recombination and/or recombinational repair.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-148
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, PLA, WB
NB100-178
Species: Hu, Mu(-)
Applications: ICC/IF, WB
NB100-177
Species: Hu, Mu, Pm, Ye
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP3-35804
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB100-165
Species: Dr, Ha, Hu
Applications: ICC/IF (-), IP, WB
NB100-181
Species: Hu, Mu
Applications: IP, WB
NBP2-02667
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB2476
Species: Hu
Applications: IHC, WB
NBP2-58116
Species: Hu
Applications: ICC/IF, KD, WB
NBP1-83077
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF3184
Species: Hu, Mu
Applications: ICC, Simple Western, WB
NB100-464
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB100-404
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
H00005810-M01J
Species: Hu
Applications: ELISA, IHC,  IHC-P, KD, ELISA(Cap), S-ELISA, WB
NB100-304
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, ISH, KD, KO, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB100-147
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, In vitro, KD, WB
NBP2-55046PEP
Species: Hu
Applications: AC

Publications for Rad51L1 Recombinant Protein Antigen (NBP2-55046PEP) (0)

There are no publications for Rad51L1 Recombinant Protein Antigen (NBP2-55046PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rad51L1 Recombinant Protein Antigen (NBP2-55046PEP) (0)

There are no reviews for Rad51L1 Recombinant Protein Antigen (NBP2-55046PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Rad51L1 Recombinant Protein Antigen (NBP2-55046PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Rad51L1 Products

Research Areas for Rad51L1 Recombinant Protein Antigen (NBP2-55046PEP)

Find related products by research area.

Blogs on Rad51L1.

Breast Cancer and RAD51L1 Antibodies
In the United States, breast cancer is one of the most common cancers and the second leading cause of cancer related deaths in women. According to the American Cancer Society's most recent estimates for breast cancer in the United States, there are ab...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Rad51L1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD51B