Rad1 Antibody (1G2)

Images

 
Western Blot: Rad1 Antibody (1G2) [H00005810-M01] - Analysis of RAD1 expression in transfected 293T cell line by RAD1 monoclonal antibody (M01), clone 1G2.Lane 1: RAD1 transfected lysate(32.43 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: Rad1 Antibody (1G2) [H00005810-M01] - Analysis of monoclonal antibody to RAD1 on formalin-fixed paraffin-embedded human lateral ventricle wall. Antibody concentration 3 ug/ml.
Western Blot: Rad1 Antibody (1G2) [H00005810-M01] - Analysis of RAD1 expression in HeLa ( Cat # L013V1 ).
Western Blot: Rad1 Antibody (1G2) [H00005810-M01] - Analysis of RAD1 over-expressed 293 cell line, cotransfected with RAD1 Validated Chimera RNAi ( Cat # H00005810-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Sandwich ELISA: Rad1 Antibody (1G2) [H00005810-M01] - Detection limit for recombinant GST tagged RAD1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P, RNAi
Clone
1G2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Rad1 Antibody (1G2) Summary

Immunogen
RAD1 (AAH06837, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIFQEFKVQEESVTFRINLTVLL
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAD1
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
Positive Control
Rad1 Lysate (NBP2-66218)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Rad1 Antibody (1G2)

  • cell cycle checkpoint protein Hrad1
  • checkpoint control protein HRAD1
  • DNA repair exonuclease rad1 homolog
  • DNA repair exonuclease REC1
  • EC 3.1.11.2
  • exonuclease homolog RAD1
  • HRAD1
  • RAD1 (S. pombe) homolog
  • RAD1 homolog (S. pombe)
  • Rad1-like DNA damage checkpoint protein
  • REC1cell cycle checkpoint protein RAD1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89445
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-58116
Species: Hu
Applications: ICC/IF
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-1768
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
NBP1-02812
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-621
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Rad1 (H00005810-M01) (0)

There are no publications for Rad1 (H00005810-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rad1 (H00005810-M01) (0)

There are no reviews for Rad1 (H00005810-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rad1 (H00005810-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Rad1 (H00005810-M01)

Discover related pathways, diseases and genes to Rad1 (H00005810-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rad1 (H00005810-M01)

Discover more about diseases related to Rad1 (H00005810-M01).
 

Pathways for Rad1 (H00005810-M01)

View related products by pathway.

PTMs for Rad1 (H00005810-M01)

Learn more about PTMs related to Rad1 (H00005810-M01).
 

Research Areas for Rad1 (H00005810-M01)

Find related products by research area.

Blogs on Rad1

There are no specific blogs for Rad1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rad1 Antibody (1G2) and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD1