Rad1 Antibody (1G2)

Product Discontinued

Rad1 Antibody (1G2) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: RAD1 (AAH06837, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIFQEFKVQEESVTFRINLTVLL
• Isotype: IgG3 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RAD1
• Purity: Ascites

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Rad1 Antibody (1G2)

• cell cycle checkpoint protein Hrad1
• checkpoint control protein HRAD1
• DNA repair exonuclease rad1 homolog
• DNA repair exonuclease REC1
• EC 3.1.11.2
• exonuclease homolog RAD1
• HRAD1
• RAD1 (S. pombe) homolog
• RAD1 homolog (S. pombe)
• Rad1-like DNA damage checkpoint protein
• REC1cell cycle checkpoint protein RAD1

Background

Human Rad1 is a component of a heterotrimeric PCNA-like complex that also contains the Rad9 and Hus1 proteins. This complex is believed to be involved in cellular responses to DNA damage, possibly by associating with Rad17 and several components of the PCNA-loading heteropentamer, replication factor C. Human Rad1 exhibits significant homology to Rad1 from S. pombe, and its expression in yeast rad1 mutants has been shown to partially restore radiation resistance and G2-checkpoint activity. It has also been shown to possess exonuclease activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAD1