Rad1 Antibody (1G2) Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
RAD1 (AAH06837, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIFQEFKVQEESVTFRINLTVLL |
Isotype |
IgG3 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
RAD1 |
Purity |
Ascites |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- RNA Inhibition
- Western Blot
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Ascites |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Rad1 Antibody (1G2)
Background
Human Rad1 is a component of a heterotrimeric PCNA-like complex that also contains the Rad9 and Hus1 proteins. This complex is believed to be involved in cellular responses to DNA damage, possibly by associating with Rad17 and several components of the PCNA-loading heteropentamer, replication factor C. Human Rad1 exhibits significant homology to Rad1 from S. pombe, and its expression in yeast rad1 mutants has been shown to partially restore radiation resistance and G2-checkpoint activity. It has also been shown to possess exonuclease activity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, KD, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IP, Simple Western, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vitro, KD, WB
Publications for Rad1 (H00005810-M01) (0)
There are no publications for Rad1 (H00005810-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Rad1 (H00005810-M01) (0)
There are no reviews for Rad1 (H00005810-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Rad1 (H00005810-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Rad1 Products
Research Areas for Rad1 (H00005810-M01)
Find related products by research area.
|
Blogs on Rad1