RABGAP1 Antibody - BSA Free

Immunohistochemistry: RABGAP1 Antibody [NBP3-35604] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using RABGAP1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: RABGAP1 Antibody [NBP3-35604] - Western blot analysis of various lysates using RABGAP1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Immunohistochemistry: RABGAP1 Antibody [NBP3-35604] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using RABGAP1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RABGAP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RABGAP1 Antibody - BSA Free (NBP3-35604) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 830-1069 of human RABGAP1 (NP_036329.3).
  
  Sequence:
  QQEDPIERFERENRRLQEANMRLEQENDDLAHELVTSKIALRKDLDNAEEKADALNKELLMTKQKLIDAEEEKRRLEEESAQLKEMCRRELDKAESEIKKNSSIIGDYKQICSQLSERLEKQQTANKVEIEKIRQKVDDCERCREFFNKEGRVKGISSTKEVLDEDTDEEKETLKNQLREMELELAQTKLQLVEAECKIQDLEHHLGLALNEVQAAKKTWFNRTLSSIKTATGVQGKETC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RABGAP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 122 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for RABGAP1 Antibody - BSA Free

• DKFZp586D2123
• GAP and centrosome-associated protein
• GAPCENA
• RAB GTPase activating protein 1
• rab GTPase-activating protein 1
• rab6 GTPase activating protein (GAP and centrosome-associated)
• Rab6 GTPase activating protein, GAPCenA
• Rab6 GTPase-activating protein GAPCenA
• RP11-123N4.2
• TBC1 domain family, member 11
• TBC1D11

Background

RABGAP1 may act as a GTPase-activating protein of RAB6A. May play a role in microtubule nucleation by centrosome. May participate in a RAB6A-mediated pathway involved in the metaphase-anaphase transition

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RABGAP1