RAB7B Antibody - Azide and BSA Free Summary
Immunogen |
RAB7B (AAH17092.1, 1 a.a. - 199 a.a.) full-length human protein. MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC |
Marker |
Late Endosome Marker |
Specificity |
RAB7B - RAB7B, member RAS oncogene family, |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
RAB7B |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for RAB7B Antibody - Azide and BSA Free
Background
Members of the RAB family of RAS related GTP binding proteins are important regulators of vesicular transport and are located in specific intracellular compartments. RAB7 has been localized to late endosomes and shown to be important in the late endocytic pathway. In addition, it has been shown to have a fundamental role in the cellular vacuolation induced by the cytotoxin VacA of Helicobacter pylori.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Mu
Applications: ICC, IHC, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Ch, Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Publications for RAB7B Antibody (H00338382-D01P) (0)
There are no publications for RAB7B Antibody (H00338382-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RAB7B Antibody (H00338382-D01P) (0)
There are no reviews for RAB7B Antibody (H00338382-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RAB7B Antibody (H00338382-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RAB7B Products
Research Areas for RAB7B Antibody (H00338382-D01P)
Find related products by research area.
|
Blogs on RAB7B