Home » RAB5C » RAB5C Research Products » RAB5C Antibody

RAB5C Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: RAB5C Antibody [NBP2-55108] - Staining of human cell line U-2 OS shows localization to endosomes.
Immunocytochemistry/ Immunofluorescence: RAB5C Antibody [NBP2-55108] - Staining of human cell line U-2 OS shows localization to endosomes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

RAB5C Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
Specificity
Specificity of human RAB5C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB5C
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
RAB5C Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RAB5C Antibody

  • L1880
  • MGC117217
  • RAB5C, member of RAS oncogene family
  • RAB5C, member RAS oncogene family
  • RAB5CL
  • RAB5L
  • RABLMGC138857
  • ras-related protein Rab-5C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Rab5a Antibody
NB120-13253
Western Blot: Rab5a Antibody [NB120-13253] - analysis of Human Cell line lysates showing detection of Rab5 protein using Rabbit Anti-Rab5 Polyclonal Antibody. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Rabbit Anti-Rab5 Polyclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Donkey Anti-Rabbit IgG: HRP for 1 hour at RT.
Immunocytochemistry/Immunofluorescence: Rab5a Antibody [NB120-13253] - Tissue: HeLa Cells. Species: Human. Fixation: 2% Formaldehyde for 20 min at RT. Primary Antibody: Rabbit Anti-Rab5 Polyclonal Antibody at 1:80 for 12 hours at 4C. Secondary Antibody: R-PE Goat Anti-Rabbit (yellow) at 1:200 for 2 hours at RT. Counterstain: DAPI (blue) nuclear stain at 1:40000 for 2 hours at RT. Localization: Cytoplasm. Melanosome. Nucleus. Magnification: 100x.
Immunohistochemistry-Paraffin: Rab5a Antibody [NB120-13253] - analysis using Rabbit Anti-Rab5 Polyclonal Antibody. Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative Solution. Primary Antibody: Rabbit Anti-Rab5 Polyclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Rabbit (green) at 1:50 for 1 hour at RT. Localization: Cytoplasm.
(2 Reviews)
(12 Publications)
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
HIV-1 Rev binding
protein (HRB) Antibod ...
NBP1-91991
Western Blot: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: HIV-1 Rev binding protein (HRB) Antibody [NBP1-91991] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Rab7a Antibody
NBP1-87174
Western Blot: Rab7a Antibody [NBP1-87174] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RAB7A antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: Rab7a Antibody [NBP1-87174] - Staining of human cell line U-251MG shows positivity in vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Rab7a Antibody [NBP1-87174] - Staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
RAB7B Antibody
(3B3)
H00338382-M01
Western Blot: RAB7B Antibody (3B3) [H00338382-M01] - RAB7B monoclonal antibody (M01), clone 3B3. Analysis of RAB7B expression in human kidney.
Immunocytochemistry/Immunofluorescence: RAB7B Antibody (3B3) [H00338382-M01] - Mouse primary cells stained with RAB7B antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: RAB7B Antibody (3B3) [H00338382-M01] - Monoclonal antibody to RAB7B ( Cat # H00338382-M01 ) on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
(2 Reviews)
(6 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
EGFR Antibody
[Unconjugated]
AF1280
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for EGFR at approximately 170 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
EGFR was detected in immersion fixed frozen sections of mouse embryo (13 d.p.c.) using Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to developing muscle. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EGFR at approximately 180-191 kDa (as indicated) using 2.5 µg/mL of Goat Anti-Mouse EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1280) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Review)
(8 Publications)
Species: Mu
Applications: WB, Simple Western, IHC
Rab5b Antibody
NBP2-94902
Western Blot: Rab5b Antibody [NBP2-94902] - Analysis of extracts of various cell lines, using Rab5b. Exposure time: 90s.
Immunocytochemistry/Immunofluorescence: Rab5b Antibody [NBP2-94902] - Analysis of L929 cells using Rab5b at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: Rab5b Antibody [NBP2-94902] - Analysis of human colon carcinoma using Rab5b at dilution of 1:100. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
EEA1 Antibody
(6D4.1D4)
NBP2-36568
Western Blot: EEA1 Antibody (6D4.1D4) [NBP2-36568] - Analysis of partial recombinant human EEA1 protein (14kDa) with EEA1 antibody clone 6D4.1D4 at 0.5 ug mL.
Immunohistochemistry-Paraffin: EEA1 Antibody (6D4.1D4) [NBP2-36568] - Analysis of FFPE tissue section of human testes using mouse monoclonal EEA1 antibody (clone 6D4.1D4) at 10 ug/ml concentration. The interstitial cells depicted a punctate to granular cytoplasmic staining pattern for EEA1 protein.
Flow (Intracellular): EEA1 Antibody (6D4.1D4) [NBP2-36568] - Intracellular staining of human EEA1 in Flow cytometry using 2.5 ug of antibody per 1 million cells. Isotype control was mouse IgG1.
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, Flow-IC
ASAP1 Antibody
NBP2-24643
Western Blot: ASAP1 Antibody [NBP2-24643] - Analysis of ASAP1 in mouse brain lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-24643 at 2.0 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Species: Mu, Rt
Applications: WB
RAB6A Antibody
NBP1-33110
Knockout Validated: RAB6A Antibody [NBP1-33110] - Wild-type (WT) and RAB6A knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RAB6A antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: RAB6A Antibody [NBP1-33110] - Wild-type (WT) and RAB6A knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RAB6A antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: RAB6A Antibody [NBP1-33110] - A549 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RAB6A protein stained by RAB6A antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(21 Reviews)
(458 Publications)
Species: Hu
Recombinant Human
RAB4B GST (N-Term) Pr ...
H00053916-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
SS18L1 Antibody
NBP2-20486
Western Blot: SS18L1 Antibody [NBP2-20486] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SS18L1 Antibody [NBP2-20486] - Immunofluorescence analysis of paraformaldehyde-fixed A431, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: SS18L1 Antibody [NBP2-20486] - Immunohistochemical analysis of paraffin-embedded Huh-7 xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
S100A10 Antibody
[Unconjugated]
AF2377
Western blot shows lysates of mouse lung and MEF mouse embryonic feeder cells. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for S100A10 at approximately 11 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
S100A10 was detected in perfusion fixed frozen sections of mouse kidney using Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane in epithelial cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of mouse lung tissue and MEF mouse embryonic feeder cells, loaded at 0.2 mg/mL. A specific band was detected for S100A10 at approximately 11 kDa (as indicated) using 1 µg/mL of Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(11 Publications)
Species: Mu
Applications: WB, Simple Western, IHC
IL-6 [HRP]
D6050
(25 Reviews)
(465 Publications)
Species: Hu
Rab11A Antibody
NBP2-49320
Western Blot: Rab11A Antibody [NBP2-49320] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue
Immunohistochemistry-Paraffin: Rab11A Antibody [NBP2-49320] - Staining of human stomach shows moderate cytoplasmic positivity in parietal cells.
Immunohistochemistry-Paraffin: Rab11A Antibody [NBP2-49320] - Staining of human colon shows moderate positivity in glandular cells.
(2 Reviews)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PRA1 Antibody
NBP1-80883
Western Blot: PRA1 Antibody [NBP1-80883] - Analysis in control (vector only transfected HEK293T lysate) and RABAC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: PRA1 Antibody [NBP1-80883] - Staining of human cell line U-251 MG shows localization to nucleoli fibrillar center and nuclear membrane.
Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883] - Staining in human cerebral cortex and liver tissues using anti-RABAC1 antibody. Corresponding RABAC1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
P11 Antibody
NBP1-82458
Immunohistochemistry-Paraffin: P11 Antibody [NBP1-82458] - Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: P11 Antibody [NBP1-82458] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: P11 Antibody [NBP1-82458] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.
Species: Hu
Applications: IHC, IHC-P
Rab4 Antibody
(4E11)
NBP2-37485
Western Blot: Rab4 Antibody (4E11) [NBP2-37485] - Analysis using RAB4A mouse mAb against Jurkat (1), HeLa (2), A549 (3), HEK293 (4), K562 (5), NIH3T3 (6), PC-12 (7), and COS7 (8) cell lysate.
Immunohistochemistry-Paraffin: Rab4 Antibody (4E11) [NBP2-37485] - Analysis of liver cancer tissues using RAB4A mouse mAb with DAB staining.
Flow Cytometry: Rab4 Antibody (4E11) [NBP2-37485] - Analysis of MCF-7 cells using RAB4A mouse mAb (green) and negative control (red).
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Neutrophil
Elastase/ELA2 Antibod ...
MAB9167
Western Blot: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - Analysis of human bone marrow tissue lysate with 0.5 ug/ml of hELA-2 Monoclonal Antibody followed by HRP-conjugated Anti-Rabbit IgG Antibody. A specific band was detected for hELA-2 at approximately 25-30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Immunocytochemistry: Neutrophil Elastase/ELA2 Antibody (950334) - Azide Free [MAB9167] - Neutrophil Elastase/ELA2 was detected in immersion fixed THP-1 cell using Neutrophil Elastase/ELA2 Monoclonal Antibody at 8 ug/ml dilution. Cells were stained using Donkey anti-Mouse IgG Secondary Antibody [NL557] (red) and counterstained with DAPI (blue). Specific staining was localized to cytoplasmic.
Immunohistochemistry: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - ELA-2 was detected in immersion fixed paraffin-embedded sections of human lymphoma using ELA-2 Monoclonal Antibody at 5 ug/ml. Tissue was stained using Mouse IgG VisUCyte HRP Polymer Antibody (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neutrophils.
(1 Review)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Wnt-11
6179-WN/CF
Wnt-11
(12 Publications)
Species: Hu

Publications for RAB5C Antibody (NBP2-55108) (0)

There are no publications for RAB5C Antibody (NBP2-55108).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB5C Antibody (NBP2-55108) (0)

There are no reviews for RAB5C Antibody (NBP2-55108). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RAB5C Antibody (NBP2-55108) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

RAB5C Knockout HeLa Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional RAB5C Products

Array NBP2-55108

Bioinformatics Tool for RAB5C Antibody (NBP2-55108)

Discover related pathways, diseases and genes to RAB5C Antibody (NBP2-55108). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB5C Antibody (NBP2-55108)

Discover more about diseases related to RAB5C Antibody (NBP2-55108).
 

Pathways for RAB5C Antibody (NBP2-55108)

View related products by pathway.

PTMs for RAB5C Antibody (NBP2-55108)

Learn more about PTMs related to RAB5C Antibody (NBP2-55108).
 

Research Areas for RAB5C Antibody (NBP2-55108)

Find related products by research area.

Blogs on RAB5C

There are no specific blogs for RAB5C, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB5C Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RAB5C