Home » RAB5C » RAB5C Antibodies » RAB5C Antibody

RAB5C Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: RAB5C Antibody [NBP2-55108] - Staining of human cell line U-2 OS shows localization to endosomes.
Immunocytochemistry/ Immunofluorescence: RAB5C Antibody [NBP2-55108] - Staining of human cell line U-2 OS shows localization to endosomes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

RAB5C Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB5C
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RAB5C Antibody

  • L1880
  • MGC117217
  • RAB5C, member of RAS oncogene family
  • RAB5C, member RAS oncogene family
  • RAB5CL
  • RAB5L
  • RABLMGC138857
  • ras-related protein Rab-5C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Rab5a Antibody
NB120-13253
Western Blot: Rab5a Antibody [NB120-13253] - Western blot analysis of Human Cell line lysates showing detection of Rab5aprotein using Rabbit Anti-Rab5aPolyclonal Antibody (NB120-13253). Load: 15 ugprotein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Rabbit Anti-Rab5aPolyclonal Antibody (NB120-13253) at 1:1000 for 2 hours at RT. Secondary Antibody: Donkey Anti-Rabbit IgG: HRP for 1 hour at RT.
Immunohistochemistry: Rab5a Antibody [NB120-13253] - Immunohistochemistry analysis using Rabbit Anti-Rab5aPolyclonal Antibody (NB120-13253). Tissue: backskin. Species: Mouse. Fixation: Bouin's Fixative Solution. Primary Antibody: Rabbit Anti-Rab5aPolyclonal Antibody (NB120-13253) at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Rabbit (green) at 1:50 for 1 hour at RT. Localization: Cytoplasm.
Immunohistochemistry-Paraffin: Rab5a Antibody [NB120-13253] - analysis using Rabbit Anti-Rab5 Polyclonal Antibody . Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative Solution. Primary Antibody: Rabbit Anti-Rab5 Polyclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Rabbit (green) at 1:50 for 1 hour at RT. Localization: Cytoplasm.
(2 Reviews)
(14 Publications)
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
HIV-1 Rev binding
protein Antibody
NBP1-91991
Immunocytochemistry/Immunofluorescence: HIV-1 Rev binding protein Antibody [NBP1-91991] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Western Blot: HIV-1 Rev binding protein Antibody [NBP1-91991] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: HIV-1 Rev binding protein Antibody [NBP1-91991] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Rab7a Antibody
NBP1-87174
Immunocytochemistry/Immunofluorescence: Rab7a Antibody [NBP1-87174] - Staining of human cell line U-251MG shows positivity in vesicles. Antibody staining is shown in green.
Western Blot: Rab7a Antibody [NBP1-87174] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Rab7a Antibody [NBP1-87174] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal cells.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
RAB7B Antibody
(3B3)
H00338382-M01
Western Blot: RAB7B Antibody (3B3) [H00338382-M01] - RAB7B expression in HeLa ( Cat # L013V1 ).
Immunohistochemistry-Paraffin: RAB7B Antibody (3B3) [H00338382-M01] - Monoclonal antibody to RAB7B ( Cat # H00338382-M01 ) on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Immunocytochemistry/Immunofluorescence: RAB7B Antibody (3B3) [H00338382-M01] - Monoclonal antibody to RAB7B (H00338382-M01) on HeLa cell . [antibody concentration 10 ug/ml]
(2 Reviews)
(6 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
EGFR Antibody
[Unconjugated]
AF231
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR was detected in immersion fixed A431 human epithelial carcinoma cell line using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(15 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Rab5b Antibody
NBP2-94902
Western Blot: Rab5b Antibody [NBP2-94902] - Analysis of extracts of various cell lines, using Rab5b . Exposure time: 90s.
Immunocytochemistry/Immunofluorescence: Rab5b Antibody [NBP2-94902] - Analysis of L929 cells using Rab5b at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry: Rab5b Antibody [NBP2-94902] - Analysis of human colon carcinoma using Rab5b at dilution of 1:100. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
EEA1 Antibody
(6D4.1D4) - BSA Free
NBP2-36568
Flow (Intracellular): EEA1 Antibody (6D4.1D4) [NBP2-36568] - Intracellular staining of human EEA1 in Flow cytometry using 2.5 ug of antibody per 1 million cells. Isotype control was mouse IgG1.
Immunohistochemistry-Paraffin: EEA1 Antibody (6D4.1D4) [NBP2-36568] - Analysis of FFPE tissue section of mouse testes using mouse monoclonal EEA1 antibody (clone 6D4.1D4) at 10 ug/ml concentration. The interstitial cells depicted a punctate to granular cytoplasmic staining pattern for EEA1 protein with no signal in other cell types.
Immunohistochemistry-Paraffin: EEA1 Antibody (6D4.1D4) [NBP2-36568] - Analysis of FFPE tissue section of human testes using mouse monoclonal EEA1 antibody (clone 6D4.1D4) at 10 ug/ml concentration. The interstitial cells depicted a punctate to granular cytoplasmic staining pattern for EEA1 protein.
(2 Publications)
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
ASAP1 Antibody
NBP2-48909
Immunohistochemistry-Paraffin: ASAP1 Antibody [NBP2-48909] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Knockout Validated: ASAP1 Antibody [NBP2-48909] - Loss of ASAP1 results in expansion of the hypertrophic zone. E15.5 Asap1+/+ (Q,R) and Asap1GT/GT (S,T). ASAP1 immunostaining indicates specific expression of ASAP1 in the perichondrium, in late hypertrophic chondrocytes and in the primary ossification center. Image collected and cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pgen.1008216) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: ASAP1 Antibody [NBP2-48909] - Immunofluorescent staining of human cell line A-431 shows localization to centrosome.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
RAB6A Antibody
NBP1-33110
Immunocytochemistry/Immunofluorescence: RAB6A Antibody [NBP1-33110] - A549 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RAB6A protein stained by RAB6A antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Western Blot: RAB6A Antibody [NBP1-33110] - A. 30 ug A549 whole cell lysate/extract B. 30 ug H1299 whole cell lysate/extract C. 30 ug HCT116 whole cell lysate/extract 12 % SDS-PAGE RAB6A antibody dilution: 1:1000
Knockout Validated: RAB6A Antibody [NBP1-33110] - Wild-type (WT) and RAB6A knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RAB6A antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(27 Reviews)
(623 Publications)
Species: Hu
Applications: BA
Recombinant Human
RAB4B GST (N-Term) Pr ...
H00053916-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
SS18L1 Antibody
NBP2-20486
Immunoprecipitation: SS18L1 Antibody [NBP2-20486] - Immunoprecipitation of CREST protein from MCF-7 whole cell extracts using 5 ug of CREST antibody [N1C2] . Western blot analysis was performed using CREST antibody [N1C2]. EasyBlot anti-Rabbit IgG was used as a secondary reagent.
Immunohistochemistry-Paraffin: SS18L1 Antibody [NBP2-20486] - Immunohistochemical analysis of paraffin-embedded Huh-7 xenograft, using antibody at 1:500 dilution.
Immunocytochemistry/Immunofluorescence: SS18L1 Antibody [NBP2-20486] - Immunofluorescence analysis of paraformaldehyde-fixed A431, using antibody at 1:500 dilution.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
S100A10 Antibody
[Unconjugated]
AF2377
Western blot shows lysates of mouse lung and MEF mouse embryonic feeder cells. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for S100A10 at approximately 11 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
S100A10 was detected in perfusion fixed frozen sections of mouse kidney using Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane in epithelial cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of mouse lung tissue and MEF mouse embryonic feeder cells, loaded at 0.2 mg/mL. A specific band was detected for S100A10 at approximately 11 kDa (as indicated) using 1 µg/mL of Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(11 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
IL-6 [HRP]
D6050
(32 Reviews)
(660 Publications)
Species: Hu
Applications: ELISA
Rab11A Antibody
NBP2-49320
Western Blot: Rab11A Antibody [NBP2-49320] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue
Immunohistochemistry-Paraffin: Rab11A Antibody [NBP2-49320] - Staining of human colon shows moderate positivity in glandular cells.
Immunohistochemistry-Paraffin: Rab11A Antibody [NBP2-49320] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
(2 Reviews)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PRA1 Antibody
NBP1-80883
Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: PRA1 Antibody [NBP1-80883] - Staining in human cerebral cortex and liver tissues using anti-RABAC1 antibody. Corresponding RABAC1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
P11 Antibody
NBP1-82458
Immunohistochemistry-Paraffin: P11 Antibody [NBP1-82458] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: P11 Antibody [NBP1-82458] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: P11 Antibody [NBP1-82458] - Staining of human esophagus, placenta, skeletal muscle and skin using Anti-ENDOU antibody NBP1-82458 (A) shows similar protein distribution across tissues to independent antibody NBP2-55877 (B).
Species: Hu
Applications: IHC, IHC-P
Rab4 Antibody
(4E11) - BSA Free
NBP2-37485
ELISA: Rab4 Antibody (4E11) [NBP2-37485] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: Rab4 Antibody (4E11) [NBP2-37485] - Analysis using RAB4A mAb against human RAB4A (AA: 22-218) recombinant protein. (Expected MW is 47.9 kDa)
Western Blot: Rab4 Antibody (4E11) [NBP2-37485] - Analysis using RAB4A mouse mAb against Jurkat (1), HeLa (2), A549 (3), HEK293 (4), K562 (5), NIH3T3 (6), PC-12 (7), and COS7 (8) cell lysate.
Species: Hu, Pm, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Neutrophil
Elastase/ELA2 Antibod ...
MAB9167
Western Blot: Neutrophil Elastase/ELA2 Antibody (950334) - Azide and BSA Free [MAB9167] - Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - Analysis of human bone marrow tissue lysate with 0.5 ug/ml of hELA-2 Monoclonal Antibody followed by HRP-conjugated Anti-Mouse IgG Antibody. A specific band was detected for hELA-2 at approximately 25-30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Immunohistochemistry: Neutrophil Elastase/ELA2 Antibody (950334) [MAB9167] - ELA-2 was detected in immersion fixed paraffin-embedded sections of human lymphoma using ELA-2 Monoclonal Antibody at 5 ug/ml. Tissue was stained using Mouse IgG VisUCyte HRP Polymer Antibody (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neutrophils .
Flow Cytometry: Neutrophil Elastase/ELA2 Antibody (950334) - Azide Free [MAB9167] - THP-1 human acute monocytic leukemia cell line treated with 3 uM monensin for 3 hours was stained with Mouse Anti-Human Neutrophil Elastase/ELA2 Monoclonal Antibody (Catalog # MAB9167, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005).
(1 Review)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Wnt-11
6179-WN/CF
Wnt-11
(16 Publications)
Species: Hu
Applications: BA

Publications for RAB5C Antibody (NBP2-55108) (0)

There are no publications for RAB5C Antibody (NBP2-55108).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB5C Antibody (NBP2-55108) (0)

There are no reviews for RAB5C Antibody (NBP2-55108). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RAB5C Antibody (NBP2-55108) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB5C Products

Array NBP2-55108

Bioinformatics Tool for RAB5C Antibody (NBP2-55108)

Discover related pathways, diseases and genes to RAB5C Antibody (NBP2-55108). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB5C Antibody (NBP2-55108)

Discover more about diseases related to RAB5C Antibody (NBP2-55108).
 

Pathways for RAB5C Antibody (NBP2-55108)

View related products by pathway.

PTMs for RAB5C Antibody (NBP2-55108)

Learn more about PTMs related to RAB5C Antibody (NBP2-55108).
 

Research Areas for RAB5C Antibody (NBP2-55108)

Find related products by research area.

Blogs on RAB5C

There are no specific blogs for RAB5C, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB5C Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RAB5C