RAB32 Antibody

Images

 
Western Blot: RAB32 Antibody [NBP1-85968] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry-Paraffin: RAB32 Antibody [NBP1-85968] - Staining of human adrenal gland shows strong cytoplasmic positivity with granular pattern in cortical cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB32 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB32
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RAB32 Protein (NBP1-85968PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAB32 Antibody

  • RAB32, member RAS oncogene family
  • ras-related protein Rab-32

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58930
Species: Hu
Applications: WB
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-50030
Species: Hu
Applications: WB, IP
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6117
Species: Hu
Applications: WB, IHC
NB100-56552
Species: Hu
Applications: WB
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45497
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB110-74570
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-Fr, IHC-P
MAB7475
Species: Hu, Rt
Applications: WB
NBP2-20039
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87177
Species: Hu
Applications: IHC, IHC-P

Publications for RAB32 Antibody (NBP1-85968) (0)

There are no publications for RAB32 Antibody (NBP1-85968).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB32 Antibody (NBP1-85968) (0)

There are no reviews for RAB32 Antibody (NBP1-85968). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB32 Antibody (NBP1-85968) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB32 Products

Bioinformatics Tool for RAB32 Antibody (NBP1-85968)

Discover related pathways, diseases and genes to RAB32 Antibody (NBP1-85968). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB32 Antibody (NBP1-85968)

Discover more about diseases related to RAB32 Antibody (NBP1-85968).
 

Pathways for RAB32 Antibody (NBP1-85968)

View related products by pathway.

PTMs for RAB32 Antibody (NBP1-85968)

Learn more about PTMs related to RAB32 Antibody (NBP1-85968).
 

Research Areas for RAB32 Antibody (NBP1-85968)

Find related products by research area.

Blogs on RAB32

There are no specific blogs for RAB32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB32 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB32