RAB31 Antibody (1C6)

Images

 
Western Blot: RAB31 Antibody (1C6) [H00011031-M01] - Western Blot detection against Immunogen (36.63 KDa).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1C6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RAB31 Antibody (1C6) Summary

Immunogen
RAB31 (AAH01148, 96 a.a. ~ 195 a.a) partial recombinant protein with GST tag.TLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEY AESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNG TIKVEKPTMQASRRCC
Localization
Cell membrane; Lipid-anchor; Cytoplasmic side.
Specificity
RAB31 - RAB31, member RAS oncogene family
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAB31
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publications using
H00011031-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB31 Antibody (1C6)

  • Rab22B
  • RAB31, member RAS oncogene family
  • Ras-related protein Rab-22B
  • ras-related protein Rab-31

Background

RAB31 (RAB31, member RAS oncogene family) is thought to be involved in trans-Golgi network to-endosome trafficking and may have a role in anterograde exit from the (trans-Golgi network) TGN.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5320
Species: Hu
Applications: WB
21740002
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP

Publications for RAB31 Antibody (H00011031-M01)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ELISA.


Filter By Application
ELISA
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for RAB31 Antibody (H00011031-M01) (0)

There are no reviews for RAB31 Antibody (H00011031-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB31 Antibody (H00011031-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB31 Products

Bioinformatics Tool for RAB31 Antibody (H00011031-M01)

Discover related pathways, diseases and genes to RAB31 Antibody (H00011031-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB31 Antibody (H00011031-M01)

Discover more about diseases related to RAB31 Antibody (H00011031-M01).
 

Pathways for RAB31 Antibody (H00011031-M01)

View related products by pathway.

Research Areas for RAB31 Antibody (H00011031-M01)

Find related products by research area.

Blogs on RAB31

There are no specific blogs for RAB31, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB31 Antibody (1C6) and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB31
Entrez
OMIM
Uniprot