RAB31 Antibody (1C6) - Azide and BSA Free

Western Blot: RAB31 Antibody (1C6) [H00011031-M01] - Rab31 expression levels in stably transfected breast cancer cells. pAb RT3-IgG specifically detects rab31 in cell lysates from stably transfected MDA-MB-231 and CAMA-1 breast cancer cells in Western blot analyses. Vector control, MDA-MB-231, or CAMA-1 cells were stably transfected with the empty vector pRcRSV; batch, parental MDA-MB-231 (low endogenous rab31 expression) or CAMA-1 (no endogenous rab31 expression) cells were stably transfected with the pRcRSV-based rab31 expression vector; high, medium or low, selected cell clones of batch-transfected MDA-MB-231 or CAMA-1 cells with differing high, medium or low protein levels of rab31. Image collected and cropped by CiteAb from the following publication (molecular-cancer.biomedcentral.com/articles/10.1186/1476-4598-11-62), licensed under a CC-BY license.

Western Blot: RAB31 Antibody (1C6) [H00011031-M01] - Western Blot detection against Immunogen (36.63 KDa) .

Western Blot: RAB31 Antibody (1C6) [H00011031-M01] - Characterization of polyclonal antibodies directed to human rab31. (A) The reaction pattern of polyclonal antibody (pAb) RT3-IgG (black) & of the pre-immune rabbit serum (gray) was analyzed by a ‘one-sided ELISA’ assay [19]. rab31-His, purified recombinant, histidine-tagged rab31, used for immunization; GST-rab31, purified recombinant GST-rab31 fusion protein; BSA, bovine serum albumin. (B) In Western blot analyses, pAb RT3-IgG strongly reacts with recombinant rab31 & not at all or only weakly with the highly homologous Rab proteins rab5 & rab22A, respectively. (C) Immunohistochemical staining of paraffin-embedded, formalin-fixed breast cancer specimens with pAb RT4-IgG. Specific immunostaining is observed in the cytoplasm as well as in the nucleus of cancer cells (upper panel, see arrow), stromal cells are stained less frequently (lower panel, see arrow). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/22920728), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: RAB31 Antibody (1C6) [H00011031-M01] - Rab31 expression levels in stably transfected breast cancer cells. (A) pAb RT3-IgG specifically detects rab31 in cell lysates from stably transfected MDA-MB-231 & CAMA-1 breast cancer cells in Western blot analyses. Vector control, MDA-MB-231, or CAMA-1 cells were stably transfected with the empty vector pRcRSV; batch, parental MDA-MB-231 (low endogenous rab31 expression) or CAMA-1 (no endogenous rab31 expression) cells were stably transfected with the pRcRSV-based rab31 expression vector; high, medium or low, selected cell clones of batch-transfected MDA-MB-231 or CAMA-1 cells with differing high, medium or low protein levels of rab31. (B) Rab31 antigen values (ng/mg of total protein) in rab31-transfected MDA-MB-231 & CAMA-1 cells, determined by rab31-ELISA. Mean values (± SEM) of at least three independent experiments are depicted. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/22920728), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clone: 1C6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RAB31 Antibody (1C6) - Azide and BSA Free Summary

• Immunogen: RAB31 (AAH01148, 96 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC
• Localization: Cell membrane; Lipid-anchor; Cytoplasmic side.
• Specificity: RAB31 - RAB31, member RAS oncogene family
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RAB31
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB31 Antibody (1C6) - Azide and BSA Free

• Rab22B
• RAB31, member RAS oncogene family
• Ras-related protein Rab-22B
• ras-related protein Rab-31

Background

RAB31 (RAB31, member RAS oncogene family) is thought to be involved in trans-Golgi network to-endosome trafficking and may have a role in anterograde exit from the (trans-Golgi network) TGN.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAB31 Antibody (H00011031-M01)(3)

Publications using H00011031-M01

• Fukuda M Rab10 regulates tubular endosome formation through KIF13A/B motors. J Cell Sci. 2019-02-19 [PMID: 30700496] (WB, Human)
• Grismayer B, Soelch S, Seubert B et al. Rab31 expression levels modulate tumor-relevant characteristics of breast cancer cells Mol Cancer 2012-08-24 [PMID: 22920728] (ELISA, Human)
• Lodhi IJ, Chiang SH, Chang L et al. Gapex-5, a Rab31 Guanine Nucleotide Exchange Factor that Regulates Glut4 Trafficking in Adipocytes. Cell Metab;5(1):59-72. 2007-01-01 [PMID: 17189207]

Bioinformatics

• Gene Symbol: RAB31
• Entrez:
  • 11031(Human)
• OMIM:
  • 605694(Human)
• Uniprot:
  • AAH01148(Human)