RAB30 Antibody - BSA Free

Western Blot: RAB30 Antibody [NBP3-09501] - Western blot analysis of RAB30 in Human Daudi. Lane A: Primary Antibody. Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 1.0 ug/ml. Peptide Concentration: 2.0 ug/ml. 25 ug lysate per lane.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RAB30 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RAB30 Antibody - BSA Free (NBP3-09501) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB30 (NP_055303). Peptide sequence ERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQN
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAB30
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RAB30 Antibody - BSA Free

• RAB30, member RAS oncogene family
• ras-related protein Rab-30

Background

RAB30( AAH14213, 1 a.a. - 204 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAB30