RAB2B Antibody

Images

 
Western Blot: RAB2B Antibody [NBP2-88110] - WB Suggested Anti-RAB2B Antibody. Titration: 1.0 ug/ml. Positive Control: U937 Whole Cell

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB2B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RAB2B. Peptide sequence: NTAKEIYRKIQQGLFDVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RAB2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAB2B Antibody

  • FLJ14824
  • member RAB2B
  • RAB2B, member RAS oncogene family
  • ras-related protein Rab-2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31480
Species: Hu
Applications: WB, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45497
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IF
NBP2-25255
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-03971
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, ChHa, Eq, Pm, Rb
Applications: WB, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61825
Species: Hu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-02340
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20868
Species: Hu
Applications: WB
MMR00
Species: Mu, Rt
NBP2-88110
Species: Hu
Applications: WB

Publications for RAB2B Antibody (NBP2-88110) (0)

There are no publications for RAB2B Antibody (NBP2-88110).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB2B Antibody (NBP2-88110) (0)

There are no reviews for RAB2B Antibody (NBP2-88110). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB2B Antibody (NBP2-88110) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RAB2B Products

Bioinformatics Tool for RAB2B Antibody (NBP2-88110)

Discover related pathways, diseases and genes to RAB2B Antibody (NBP2-88110). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB2B Antibody (NBP2-88110)

Discover more about diseases related to RAB2B Antibody (NBP2-88110).
 

Pathways for RAB2B Antibody (NBP2-88110)

View related products by pathway.

Research Areas for RAB2B Antibody (NBP2-88110)

Find related products by research area.

Blogs on RAB2B

There are no specific blogs for RAB2B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB2B