RAB19B Antibody - BSA Free

Immunohistochemistry-Paraffin: RAB19B Antibody [NBP2-13188] Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RAB19B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LIGNKCDLWEKRHVLFEDACTLAEKYGLLAVLETSAKES
• Predicted Species: Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAB19
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RAB19B Protein (NBP2-13188PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RAB19B Antibody - BSA Free

• RAB19, member RAS oncogene family
• RAB19BGTP-binding protein RAB19B
• ras-related protein Rab-19

Background

RAB19B, also known as Ras-related protein Rab-19, is a 24 kDa 217 amino acid protein with a longer 30kDa 264 isoform. RAB19B belongs to the Rab family and can be found in the cell membrane. Current research on RAB19B is being conducted in relation to the diseases pilocytic astrocytoma and astrocytoma. RAB19B is linked to the transport pathway where it interacts with RANBP1, RANBP2, RANGAP1, ARHGDIA and KPNB1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAB19