RAB19B Antibody

Images

 
Immunohistochemistry-Paraffin: RAB19B Antibody [NBP2-13188] Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RAB19B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LIGNKCDLWEKRHVLFEDACTLAEKYGLLAVLETSAKES
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RAB19B Protein (NBP2-13188PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RAB19B Antibody

  • RAB19, member RAS oncogene family
  • RAB19BGTP-binding protein RAB19B
  • ras-related protein Rab-19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

24320002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-86528
Species: Hu
Applications: IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45497
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-92307
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00028996-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
21740002
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00339122-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-31631
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP2-13188
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for RAB19B Antibody (NBP2-13188) (0)

There are no publications for RAB19B Antibody (NBP2-13188).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB19B Antibody (NBP2-13188) (0)

There are no reviews for RAB19B Antibody (NBP2-13188). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RAB19B Antibody (NBP2-13188) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB19B Products

Bioinformatics Tool for RAB19B Antibody (NBP2-13188)

Discover related pathways, diseases and genes to RAB19B Antibody (NBP2-13188). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for RAB19B Antibody (NBP2-13188)

Find related products by research area.

Blogs on RAB19B

There are no specific blogs for RAB19B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB19B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB19