Rab27a Antibody

Images

 
Western Blot: Rab27a Antibody [NBP1-83327] - Analysis in human cell line HL-60.
Immunohistochemistry-Paraffin: Rab27a Antibody [NBP1-83327] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Western Blot: Rab27a Antibody [NBP1-83327] - Analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-RAB27A antibody. Corresponding RAB27A RNA-seq data are presented for the same cell lines. Loading control: ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
       

Orthogonal Strategies

 

Order Details

Rab27a Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAB27A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Rab27a Protein (NBP1-83327PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Rab27a Antibody

  • GS2
  • GS2rab-27
  • GTP-binding protein Ram
  • HsT18676
  • Rab-27
  • Rab27a
  • RAB27A, member RAS oncogene family
  • RAB27MGC117246
  • RAM
  • RAMras-related protein Rab-27A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB300-943
Species: Mu
Applications: WB, ICC/IF, IHC-P, PEP-ELISA
NBP1-92156
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00487
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
H00005874-B01P
Species: Hu, Rb
Applications: WB, ICC/IF
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-41385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-86176
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1278
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
NBP1-84764
Species: Hu
Applications: IHC, IHC-P
NBP1-80991
Species: Hu
Applications: IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00004218-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Rab27a Antibody (NBP1-83327) (0)

There are no publications for Rab27a Antibody (NBP1-83327).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rab27a Antibody (NBP1-83327) (0)

There are no reviews for Rab27a Antibody (NBP1-83327). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rab27a Antibody (NBP1-83327) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rab27a Products

Bioinformatics Tool for Rab27a Antibody (NBP1-83327)

Discover related pathways, diseases and genes to Rab27a Antibody (NBP1-83327). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rab27a Antibody (NBP1-83327)

Discover more about diseases related to Rab27a Antibody (NBP1-83327).
 

Pathways for Rab27a Antibody (NBP1-83327)

View related products by pathway.

PTMs for Rab27a Antibody (NBP1-83327)

Learn more about PTMs related to Rab27a Antibody (NBP1-83327).
 

Research Areas for Rab27a Antibody (NBP1-83327)

Find related products by research area.

Blogs on Rab27a

There are no specific blogs for Rab27a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rab27a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB27A
Entrez