Rab27a Antibody - BSA Free

Immunohistochemistry-Paraffin: Rab27a Antibody [NBP1-83327] - Analysis in human stomach and skeletal muscle tissues. Corresponding RAB27A RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Rab27a Antibody [NBP1-83327] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Rab27a Antibody [NBP1-83327] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells with additional stron membranous positivity in a subset of glandular cells.

Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-RAB27A antibody. Corresponding RAB27A RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Rab27a Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Rab27a Antibody - BSA Free (NBP1-83327) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLS
• Predicted Species: Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAB27A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Rab27a Protein (NBP1-83327PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Rab27a Antibody - BSA Free

• GS2
• GS2rab-27
• GTP-binding protein Ram
• HsT18676
• Rab-27
• Rab27a
• RAB27A, member RAS oncogene family
• RAB27MGC117246
• RAM
• RAMras-related protein Rab-27A

Background

RAB27A is encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAB27A