Rab20 Antibody - Azide and BSA Free

Western Blot: Rab20 Antibody [H00055647-B01P] - Analysis of RAB20 expression in transfected 293T cell line by RAB20 polyclonal antibody. Lane 1: RAB20 transfected lysate(25.74 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Rab20 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Rab20 Antibody - Azide and BSA Free (H00055647-B01P) is a polyclonal antibody validated for use in WB. Anti-Rab20 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: RAB20 (NP_060287.1, 1 a.a. - 234 a.a.) full-length human protein. MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYCRGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA
• Specificity: RAB20 - RAB20, member RAS oncogene family,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: RAB20
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Rab20 Antibody - Azide and BSA Free

• FLJ20429
• RAB20, member RAS oncogene family
• ras-related protein Rab-20

Background

RAB20, also known as Ras-related protein Rab-20, is a 234 amino acid protein that is 26 kDa, belongs to the small GTPase superfamily, expressed in 15 of 18 exocrine pancreatic adenocarcinomas, plays a role in apical endocytosis/recycling, maturation and acidification of phagosomes that engulf pathogens such as S.aureus and M.tuberculosis, and in the fusion of phagosomes with lysosomes. This protein is currently being studied for its involvement in hemophagocytic lymphohistiocytosis, pancreatic carcinoma, pancreatitis, adenocarcinoma, and carcinoma. RAB20 protein has interactions with SMURF1, SMAD4 and TGFBR1 in Epithelial Tight Junctions pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Rab20 Antibody (H00055647-B01P)(1)

Publication using H00055647-B01P

• Hackenbeck T, Huber R, Schietke R et al. The GTPase RAB20 is a HIF target with mitochondrial localization mediating apoptosis in hypoxia. Biochim Biophys Acta 1813(1):1-13. 2011-01-01 [PMID: 21056597]

Bioinformatics

• Gene Symbol: RAB20
• Entrez:
  • 55647(Human)
• Uniprot:
  • NP_060287.1(Human)