QTRT1 Antibody

Images

 
Western Blot: QTRT1 Antibody [NBP1-53056] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

QTRT1 Antibody Summary

Immunogen
Synthetic peptides corresponding to QTRT1(queuine tRNA-ribosyltransferase 1 (tRNA-guanine transglycosylase)) The peptide sequence was selected from the middle region of QTRT1. Peptide sequence KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
QTRT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against QTRT1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for QTRT1 Antibody

  • EC 2.4.2.29
  • Guanine insertion enzyme
  • queuine tRNA-ribosyltransferase 1
  • queuine tRNA-ribosyltransferase
  • TGTFP3235
  • TGUT
  • tRNA-guanine transglycosylase

Background

tRNA-guanine transglycosylase (TGT; EC 2.4.2.29) synthesizes queuosine (Q), which is found in tRNAs that recognize NAU and NAC codons, encoding tyr, asn, asp, and his. Prokaryotic TGT is a single protein of 43 kD. In contrast, mammalian TGT appears to be a heterodimer consisting of a 60-kD subunit (USP14; MIM 607274) and a 43-kD catalytic subunit (QTRT1). tRNA-guanine transglycosylase (TGT; EC 2.4.2.29) synthesizes queuosine (Q), which is found in tRNAs that recognize NAU and NAC codons, encoding tyr, asn, asp, and his. Prokaryotic TGT is a single protein of 43 kD. In contrast, mammalian TGT appears to be a heterodimer consisting of a 60-kD subunit (USP14; MIM 607274) and a 43-kD catalytic subunit (QTRT1) (Deshpande and Katze, 2001 [PubMed 11255023]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-59448
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30013
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
H00009097-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-42664
Species: Hu
Applications: WB, IHC, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85332
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-46016
Species: Hu, Mu, Ca, Mk
Applications: WB, IF
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53056
Species: Hu, Mu
Applications: WB

Publications for QTRT1 Antibody (NBP1-53056) (0)

There are no publications for QTRT1 Antibody (NBP1-53056).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for QTRT1 Antibody (NBP1-53056) (0)

There are no reviews for QTRT1 Antibody (NBP1-53056). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for QTRT1 Antibody (NBP1-53056). (Showing 1 - 1 of 1 FAQ).

  1. We are interested in using an anti-QTRT1 antibody in Amoeba model. This sequence shares a 60% homology with the peptide which was used as an Immunogen of NBP1-53056.
    • Normally, we like to see 80% homology or better for cross reactive species. However, it is definitely possible that this antibody may recognize the amoeba protein as some sections of the immunogen are conserved in the amoeba protein. Since this species has not been tested and the homology is less than 90%, we unfortunately cannot guarantee cross reactivity. We can offer our Innovator's Reward program, if your customer is still interested in trying this item. The program works by purchasing the item as normal, having your customer try the antibody and report their results as a review (positive or negative results). The review can be submitted online or by email to Innovators Reward. Once the review is received, we will provide you a credit for the purchase price of the antibody to provide to your customer for a future purchase. Details for this program can be found here: Innovators Reward

Secondary Antibodies

 

Isotype Controls

Additional QTRT1 Products

Bioinformatics Tool for QTRT1 Antibody (NBP1-53056)

Discover related pathways, diseases and genes to QTRT1 Antibody (NBP1-53056). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for QTRT1 Antibody (NBP1-53056)

View related products by pathway.

Blogs on QTRT1

There are no specific blogs for QTRT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our QTRT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol QTRT1
Uniprot