QTRT1 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to QTRT1(queuine tRNA-ribosyltransferase 1 (tRNA-guanine transglycosylase)) The peptide sequence was selected from the middle region of QTRT1. Peptide sequence KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
QTRT1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for QTRT1 Antibody - BSA Free
Background
tRNA-guanine transglycosylase (TGT; EC 2.4.2.29) synthesizes queuosine (Q), which is found in tRNAs that recognize NAU and NAC codons, encoding tyr, asn, asp, and his. Prokaryotic TGT is a single protein of 43 kD. In contrast, mammalian TGT appears to be a heterodimer consisting of a 60-kD subunit (USP14; MIM 607274) and a 43-kD catalytic subunit (QTRT1). tRNA-guanine transglycosylase (TGT; EC 2.4.2.29) synthesizes queuosine (Q), which is found in tRNAs that recognize NAU and NAC codons, encoding tyr, asn, asp, and his. Prokaryotic TGT is a single protein of 43 kD. In contrast, mammalian TGT appears to be a heterodimer consisting of a 60-kD subunit (USP14; MIM 607274) and a 43-kD catalytic subunit (QTRT1) (Deshpande and Katze, 2001 [PubMed 11255023]).[supplied by OMIM].
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Publications for QTRT1 Antibody (NBP1-53056) (0)
There are no publications for QTRT1 Antibody (NBP1-53056).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for QTRT1 Antibody (NBP1-53056) (0)
There are no reviews for QTRT1 Antibody (NBP1-53056).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for QTRT1 Antibody (NBP1-53056). (Showing 1 - 1 of 1 FAQ).
-
We are interested in using an anti-QTRT1 antibody in Amoeba model. This sequence shares a 60% homology with the peptide which was used as an Immunogen of NBP1-53056.
- Normally, we like to see 80% homology or better for cross reactive species. However, it is definitely possible that this antibody may recognize the amoeba protein as some sections of the immunogen are conserved in the amoeba protein. Since this species has not been tested and the homology is less than 90%, we unfortunately cannot guarantee cross reactivity. We can offer our Innovator's Reward program, if your customer is still interested in trying this item. The program works by purchasing the item as normal, having your customer try the antibody and report their results as a review (positive or negative results). The review can be submitted online or by email to Innovators Reward. Once the review is received, we will provide you a credit for the purchase price of the antibody to provide to your customer for a future purchase. Details for this program can be found here: Innovators Reward
Secondary Antibodies
| |
Isotype Controls
|
Additional QTRT1 Products
Research Areas for QTRT1 Antibody (NBP1-53056)
Find related products by research area.
|
Blogs on QTRT1