DARS2 Antibody

Images

 
Western Blot: DARS2 Antibody [NBP1-83854] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: DARS2 Antibody [NBP1-83854] - Staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: DARS2 Antibody [NBP1-83854] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DARS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DARS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DARS2 Protein (NBP1-83854PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DARS2 Antibody

  • aspartate tRNA ligase 2, mitochondrial
  • Aspartate--tRNA ligase
  • aspartyl-tRNA synthetase 2, mitochondrial
  • aspartyl-tRNA synthetase, mitochondrial
  • AspRS
  • ASPRS. LBSL
  • EC 6.1.1
  • EC 6.1.1.12
  • FLJ10514
  • LBSL
  • MT-ASPRS
  • RP3-383J4.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13640
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82077
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006301-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-87706
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33807
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20928
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33633
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38035
Species: Hu
Applications: IHC, IHC-P
NBP2-20567
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90079
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87698
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DARS2 Antibody (NBP1-83854) (0)

There are no publications for DARS2 Antibody (NBP1-83854).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DARS2 Antibody (NBP1-83854) (0)

There are no reviews for DARS2 Antibody (NBP1-83854). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DARS2 Antibody (NBP1-83854) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DARS2 Products

Bioinformatics Tool for DARS2 Antibody (NBP1-83854)

Discover related pathways, diseases and genes to DARS2 Antibody (NBP1-83854). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DARS2 Antibody (NBP1-83854)

Discover more about diseases related to DARS2 Antibody (NBP1-83854).
 

Pathways for DARS2 Antibody (NBP1-83854)

View related products by pathway.

Research Areas for DARS2 Antibody (NBP1-83854)

Find related products by research area.

Blogs on DARS2

There are no specific blogs for DARS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DARS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DARS2