NARS2 Antibody

Images

 
Western Blot: NARS2 Antibody [NBP1-82077] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: NARS2 Antibody [NBP1-82077] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & mitochondria.
Immunohistochemistry-Paraffin: NARS2 Antibody [NBP1-82077] - Staining of human kidney shows strong cytoplasmic positivity with a granular pattern in tubule cells.
Simple Western: NARS2 Antibody [NBP1-82077] - Simple Western lane view shows a specific band for NARS2 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: NARS2 Antibody [NBP1-82077] - Electropherogram image(s) of corresponding Simple Western lane view. NARS2 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NARS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LAEFYMIEAEISFVDSLQDLMQVIEELFKATTMMVLSKCPEDVELCHKFIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLRTEHEKYLVKHCGNIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDLLVPGVG
Specificity
Specificity of human NARS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NARS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Simple Western 1:20
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
NARS2 Protein (NBP1-82077PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-82077 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NARS2 Antibody

  • asnRS
  • asparagine tRNA ligase 2, mitochondrial (putative)
  • Asparagine--tRNA ligase
  • asparaginyl-tRNA synthetase 2, mitochondrial (putative)
  • EC 6.1.1
  • EC 6.1.1.22
  • FLJ23441
  • probable asparaginyl-tRNA synthetase, mitochondrial
  • SLM5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13640
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85937
Species: Hu, Mu
Applications: WB, IHC, IHC-P, KD
NBP1-83855
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87706
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92106
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87414
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86624
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20928
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91857
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57679
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84637
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20744
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87698
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56375
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20567
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for NARS2 Antibody (NBP1-82077) (0)

There are no publications for NARS2 Antibody (NBP1-82077).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for NARS2 Antibody (NBP1-82077) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-82077:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot NARS2 NBP1-82077
Enlarge
reviewed by:
Anonymous
WB Human 08/13/2014
View

Summary

ApplicationWestern Blot
Sample TestedHuman fibroblast and HeLa whole cell lysate
SpeciesHuman

Blocking

Blocking Details5% milk in TBST for 1 hour at room temperature OR at 4 degrees overnight, with equal results

Primary Anitbody

Dilution Ratio1:1000 dilution in 0.5X TBST with 0.1% BSA and 0.1% NaN3. Incubation for 1 hour at RT OR at 4 degrees overnight.

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP
Secondary Manufacturer Cat#Bio-Rad 172-1019
Secondary Concentration1:25,000 dilution

Details

Detection NotesECL using Thermo Fisher Scientific SuperSignal West Femto. Detection using Bio-Rad Chemi-Doc XRS+ system. Exposure 60-200 sec.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NARS2 Antibody (NBP1-82077) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NARS2 Antibody (NBP1-82077)

Discover related pathways, diseases and genes to NARS2 Antibody (NBP1-82077). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NARS2 Antibody (NBP1-82077)

Discover more about diseases related to NARS2 Antibody (NBP1-82077).
 

Pathways for NARS2 Antibody (NBP1-82077)

View related products by pathway.

PTMs for NARS2 Antibody (NBP1-82077)

Learn more about PTMs related to NARS2 Antibody (NBP1-82077).

Blogs on NARS2

There are no specific blogs for NARS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
08/13/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol NARS2