NARS2 Antibody

Western Blot: NARS2 Antibody [NBP1-82077] - Analysis in human cell line K562.

Immunocytochemistry/Immunofluorescence: NARS2 Antibody [NBP1-82077] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NARS2 Antibody [NBP1-82077] - Staining of human kidney shows strong cytoplasmic positivity with a granular pattern in tubule cells.

Simple Western: NARS2 Antibody [NBP1-82077] - Simple Western lane view shows a specific band for NARS2 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: NARS2 Antibody [NBP1-82077] - Electropherogram image(s) of corresponding Simple Western lane view. NARS2 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).

• Reactivity: Hu
• Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NARS2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LAEFYMIEAEISFVDSLQDLMQVIEELFKATTMMVLSKCPEDVELCHKFIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLRTEHEKYLVKHCGNIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDLLVPGVG
• Specificity: Specificity of human NARS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NARS2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml
  • Simple Western 1:20
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  NARS2 Protein (NBP1-82077PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NARS2 Antibody

• asnRS
• asparagine tRNA ligase 2, mitochondrial (putative)
• Asparagine--tRNA ligase
• asparaginyl-tRNA synthetase 2, mitochondrial (putative)
• EC 6.1.1
• EC 6.1.1.22
• FLJ23441
• probable asparaginyl-tRNA synthetase, mitochondrial
• SLM5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for NARS2 Antibody (NBP1-82077) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Anonymous WB Human 08/13/2014

Summary

• Application: Western Blot
• Sample Tested: Human fibroblast and HeLa whole cell lysate
• Species: Human

Blocking

• Blocking Details: 5% milk in TBST for 1 hour at room temperature OR at 4 degrees overnight, with equal results

Primary Anitbody

• Dilution Ratio: 1:1000 dilution in 0.5X TBST with 0.1% BSA and 0.1% NaN3. Incubation for 1 hour at RT OR at 4 degrees overnight.

Secondary Antibody

• Secondary Description: Goat anti-rabbit IgG, HRP
• Secondary Manufacturer Cat#: Bio-Rad 172-1019
• Secondary Concentration: 1:25,000 dilution

Details

• Detection Notes: ECL using Thermo Fisher Scientific SuperSignal West Femto. Detection using Bio-Rad Chemi-Doc XRS+ system. Exposure 60-200 sec.

Bioinformatics

• Gene Symbol: NARS2