Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5)

Western Blot: Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5) [NBP3-16455] - Western blot analysis of extracts of various cell lines, using Pyruvate Dehydrogenase E1 beta subunit Rabbit mAb (NBP3-16455) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry: Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5) [NBP3-16455] - Immunohistochemistry analysis of Pyruvate Dehydrogenase E1 beta subunit in paraffin-embedded mouse kidney tissue using Pyruvate Dehydrogenase E1 beta subunit Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5) [NBP3-16455] - Immunohistochemistry analysis of Pyruvate Dehydrogenase E1 beta subunit in paraffin-embedded human thyroid cancer tissue using Pyruvate Dehydrogenase E1 beta subunit Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5) [NBP3-16455] - Immunohistochemistry analysis of Pyruvate Dehydrogenase E1 beta subunit in paraffin-embedded human lung cancer tissue using Pyruvate Dehydrogenase E1 beta subunit Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5) [NBP3-16455] - Immunohistochemistry analysis of Pyruvate Dehydrogenase E1 beta subunit in paraffin-embedded human liver cancer tissue using Pyruvate Dehydrogenase E1 beta subunit Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5) [NBP3-16455] - Immunohistochemistry analysis of Pyruvate Dehydrogenase E1 beta subunit in paraffin-embedded human colon carcinoma tissue using Pyruvate Dehydrogenase E1 beta subunit Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5) [NBP3-16455] - Immunohistochemistry analysis of Pyruvate Dehydrogenase E1 beta subunit in paraffin-embedded rat kidney tissue using Pyruvate Dehydrogenase E1 beta subunit Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 7V8O5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 260-359 of human Pyruvate Dehydrogenase E1 beta subunit (P11177). GVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFGVGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLNI
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PDHB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Pyruvate Dehydrogenase E1 beta subunit Antibody (7V8O5)

• DKFZp564K0164
• mitochondrial
• pyruvate dehydrogenase (lipoamide) beta
• pyruvate dehydrogenase, E1 beta polypeptide

Background

The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDHB