PTPRB Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PTPRB Antibody [NBP2-56421] - Staining of human cell line A-431 shows localization to plasma membrane & vesicles. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTPRB Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HPLPSYLEYRHNASIRVYQTNYFASKCAENPNSNSKSFNIKLGAEMESLGGKCDPTQQKFCDGPLKPHTAYRISIRAFTQLFDEDLKEFTKPLYSD
Specificity
Specificity of human PTPRB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTPRB
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PTPRB Antibody

  • DKFZp686E2262
  • DKFZp686H15164
  • EC 3.1.3.48
  • FLJ44133
  • HPTPB
  • HPTP-BETA
  • MGC142023
  • MGC59935
  • protein tyrosine phosphatase, receptor type, B
  • protein tyrosine phosphatase, receptor type, beta polypeptide
  • Protein-tyrosine phosphatase beta
  • PTPB
  • receptor-type tyrosine-protein phosphatase beta
  • R-PTP-BETA
  • Vascular endothelial protein tyrosine phosphatase
  • VEPTP
  • VE-PTP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
AF1002
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC-Fr, IF
AF313
Species: Hu
Applications: WB, Simple Western, IHC, Block
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
MAB7475
Species: Hu, Rt
Applications: WB
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF1366
Species: Hu
Applications: WB, Simple Western, IHC
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
NBP1-84680
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-56421
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for PTPRB Antibody (NBP2-56421) (0)

There are no publications for PTPRB Antibody (NBP2-56421).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTPRB Antibody (NBP2-56421) (0)

There are no reviews for PTPRB Antibody (NBP2-56421). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PTPRB Antibody (NBP2-56421) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PTPRB Products

Array NBP2-56421

Bioinformatics Tool for PTPRB Antibody (NBP2-56421)

Discover related pathways, diseases and genes to PTPRB Antibody (NBP2-56421). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTPRB Antibody (NBP2-56421)

Discover more about diseases related to PTPRB Antibody (NBP2-56421).
 

Pathways for PTPRB Antibody (NBP2-56421)

View related products by pathway.

PTMs for PTPRB Antibody (NBP2-56421)

Learn more about PTMs related to PTPRB Antibody (NBP2-56421).

Blogs on PTPRB

There are no specific blogs for PTPRB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTPRB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPRB