PTPN4 Antibody

Western Blot: PTPN4 Antibody [NBP1-80867] - Analysis in human cell line HDLM-2.

Immunocytochemistry/Immunofluorescence: PTPN4 Antibody [NBP1-80867] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PTPN4 Antibody [NBP1-80867] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: PTPN4 Antibody [NBP1-80867] - Staining of human duodenum shows moderate positivity in apical membrane in glandular cells.

Immunohistochemistry-Paraffin: PTPN4 Antibody [NBP1-80867] - Staining of human kidney shows strong membranous positivity in cells in tubules.

Product Discontinued

PTPN4 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQVTCHSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFL
• Predicted Species: Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTPN4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PTPN4 Antibody

• EC 3.1.3.48
• MEG
• megakaryocyte phosphatase
• megakaryocyte protein-tyrosine phosphatase
• protein tyrosine phosphatase MEG1
• protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte)
• Protein-tyrosine phosphatase MEG1
• PTPase-MEG1
• PTPMEG
• PTPMEG1
• PTPN4
• tyrosine-protein phosphatase non-receptor type 4

Background

PTPN4 is encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This protein contains a C-terminal PTP domain and an N-terminal domain homologous to the band 4.1 superfamily of cytoskeletal-associated proteins. This PTP has been shown to interact with glutamate receptor delta 2 and epsilon subunits, and is thought to play a role in signalling downstream of the glutamate receptors through tyrosine dephosphorylation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PTPN4 Antibody (NBP1-80867)(2)

Publications using NBP1-80867

• Zhang X, Lao M, Yang H et al. Targeting cancer-associated fibroblast autophagy renders pancreatic cancer eradicable with immunochemotherapy by inhibiting adaptive immune resistance Research Square 2022-11-09 (Human, Mouse)
• Cao Z, Liu J, Zhao Z, Wang Q miR-16-5p Regulates PTPN4 and Affects Cardiomyocyte Apoptosis and Autophagy Induced by Hypoxia/Reoxygenation Evidence-based complementary and alternative medicine : eCAM 2021-06-16 [PMID: 34306144]

Bioinformatics

• Gene Symbol: PTPN4
• Entrez:
  • 5775(Human)
• Uniprot:
  • P29074(Human)