PTPLAD2 Antibody - BSA Free

Western Blot: PTPLAD2 Antibody [NBP1-59414] - 293T cells lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PTPLAD2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PTPLAD2(protein tyrosine phosphatase-like A domain containing 2) The peptide sequence was selected from the middle region of PTPLAD2. Peptide sequence LLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFW. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTPLAD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PTPLAD2 Antibody - BSA Free

• DKFZp686F01145
• DKFZp686G24132
• EC 4.2.1.-
• Em:AL662879.1
• HACD4
• protein tyrosine phosphatase-like A domain containing 2
• Protein tyrosine phosphatase-like protein PTPLAD2,3-hydroxyacyl-CoA dehydratase 4
• Protein-tyrosine phosphatase-like A domain-containing protein 2

Background

PTPLAD2 is a multi-pass membrane protein. It belongs to the PTPLA family. The function of the PTPLAD2 protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTPLAD2
• Uniprot:
  • Q5VWC8(Human)