NAV3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NAV3 Antibody [NBP1-82951] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane & cytosol.
Immunohistochemistry-Paraffin: NAV3 Antibody [NBP1-82951] - Staining of human duodenum shows strong membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NAV3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:STDDLNTTSSVSSYSNITVPSRKNTQLRTDSEKRSTTDETWDSPEELKKPEEDFDSHGDAGGKWKTVSSGLPEDPEKAGQKASLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAV3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NAV3 Protein (NBP1-82951PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NAV3 Antibody

  • KIAA0938pore membrane and/or filament interacting like protein 1
  • neuron navigator 3
  • POMFIl1
  • POMFIL1steerin 3
  • Pore membrane and/or filament-interacting-like protein 1
  • STEERIN3
  • steerin-3
  • Unc-53 homolog 3
  • unc53H3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91787
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00022932-M02
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-84615
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84082
Species: Hu
Applications: IHC, IHC-P
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
AF1062
Species: Mu
Applications: WB, IHC, Neut
3900-WN/CF
Species: Mu
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NBP1-81426
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82951
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for NAV3 Antibody (NBP1-82951) (0)

There are no publications for NAV3 Antibody (NBP1-82951).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAV3 Antibody (NBP1-82951) (0)

There are no reviews for NAV3 Antibody (NBP1-82951). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NAV3 Antibody (NBP1-82951) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NAV3 Products

Bioinformatics Tool for NAV3 Antibody (NBP1-82951)

Discover related pathways, diseases and genes to NAV3 Antibody (NBP1-82951). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAV3 Antibody (NBP1-82951)

Discover more about diseases related to NAV3 Antibody (NBP1-82951).
 

Pathways for NAV3 Antibody (NBP1-82951)

View related products by pathway.

Research Areas for NAV3 Antibody (NBP1-82951)

Find related products by research area.

Blogs on NAV3

There are no specific blogs for NAV3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAV3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAV3