NAV3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NAV3 Antibody [NBP1-82951] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane & cytosol.

Immunohistochemistry-Paraffin: NAV3 Antibody [NBP1-82951] - Staining of human duodenum shows strong membranous and cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NAV3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: STDDLNTTSSVSSYSNITVPSRKNTQLRTDSEKRSTTDETWDSPEELKKPEEDFDSHGDAGGKWKTVSSGLPEDPEKAGQKASLS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NAV3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NAV3 Protein (NBP1-82951PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NAV3 Antibody - BSA Free

• KIAA0938pore membrane and/or filament interacting like protein 1
• neuron navigator 3
• POMFIl1
• POMFIL1steerin 3
• Pore membrane and/or filament-interacting-like protein 1
• STEERIN3
• steerin-3
• Unc-53 homolog 3
• unc53H3

Background

The NAV3 gene belongs to the neuron navigator family and is expressed predominantly in the nervous system. The encodedprotein contains coiled-coil domains and a conserved AAA domain characteristic for ATPases associated with a varietyof cellular activities. T

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAV3