PTPLAD1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PTPLAD1 Antibody [NBP1-88597] - Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: PTPLAD1 Antibody [NBP1-88597] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTPLAD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTPLAD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PTPLAD1 Protein (NBP1-88597PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PTPLAD1 Antibody

  • BIND1
  • B-ind1
  • Butyrate-induced protein 1
  • butyrate-induced transcript 1
  • EC 4.2.1.-
  • FLJ90376
  • HACD3
  • hB-ind1
  • HSPC121,3-hydroxyacyl-CoA dehydratase 3
  • protein tyrosine phosphatase-like A domain containing 1
  • Protein tyrosine phosphatase-like protein PTPLAD1
  • Protein-tyrosine phosphatase-like A domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF3580
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
AF7250
Species: Hu
Applications: IHC
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-36431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-68211
Species: Hu
Applications: WB, IP
MAB6799
Species: Hu
Applications: WB, IHC
NBP1-88597
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PTPLAD1 Antibody (NBP1-88597) (0)

There are no publications for PTPLAD1 Antibody (NBP1-88597).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTPLAD1 Antibody (NBP1-88597) (0)

There are no reviews for PTPLAD1 Antibody (NBP1-88597). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PTPLAD1 Antibody (NBP1-88597) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTPLAD1 Products

Bioinformatics Tool for PTPLAD1 Antibody (NBP1-88597)

Discover related pathways, diseases and genes to PTPLAD1 Antibody (NBP1-88597). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTPLAD1 Antibody (NBP1-88597)

Discover more about diseases related to PTPLAD1 Antibody (NBP1-88597).
 

Pathways for PTPLAD1 Antibody (NBP1-88597)

View related products by pathway.

Research Areas for PTPLAD1 Antibody (NBP1-88597)

Find related products by research area.

Blogs on PTPLAD1

There are no specific blogs for PTPLAD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTPLAD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPLAD1