PTPLAD1 Antibody - BSA Free

Western Blot: PTPLAD1 Antibody [NBP1-59028] - Human Muscle lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PTPLAD1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PTPLAD1(protein tyrosine phosphatase-like A domain containing 1) The peptide sequence was selected from the N terminal of PTPLAD1. Peptide sequence WLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTPLAD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PTPLAD1 Antibody - BSA Free

• BIND1
• B-ind1
• Butyrate-induced protein 1
• butyrate-induced transcript 1
• EC 4.2.1.-
• FLJ90376
• HACD3
• hB-ind1
• HSPC121,3-hydroxyacyl-CoA dehydratase 3
• protein tyrosine phosphatase-like A domain containing 1
• Protein tyrosine phosphatase-like protein PTPLAD1
• Protein-tyrosine phosphatase-like A domain-containing protein 1

Background

PTPLAD1 is a multi-pass membrane protein. It belongs to the PTPLA family and contains 1 CS domain. PTPLAD1 (hB-ind1) plays a crucial role in HCV RNA replication and the propagation of JFH1 virus through interaction with viral and host proteins. It is involved in Rac1-signaling pathways leading to the modulation of gene expression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTPLAD1