PTP4A1 Antibody

Images

 
Western Blot: PTP4A1 Antibody [NBP1-87224] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: PTP4A1 Antibody [NBP1-87224] - Staining of human placenta shows distinct positivity in Hofbauer cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTP4A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTP4A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PTP4A1 Protein (NBP1-87224PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PTP4A1 Antibody

  • EC 3.1.3.48
  • HH72
  • PRL1
  • PRL-1
  • PRL-1DKFZp779M0721
  • Protein tyrosine phosphatase IVA1
  • protein tyrosine phosphatase type IVA 1
  • protein tyrosine phosphatase type IVA protein 1
  • protein tyrosine phosphatase type IVA, member 1
  • Protein-tyrosine phosphatase 4a1
  • Protein-tyrosine phosphatase of regenerating liver 1
  • PTP(CAAX1)
  • PTP(CAAXI)
  • PTPCAAX1PRL1PTP(CAAX1)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3219
Species: Hu, Mu, Rt
Applications: WB
NBP2-30075
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB7475
Species: Hu, Rt
Applications: WB
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
AF4937
Species: Hu
Applications: WB, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88667
Species: Hu
Applications: IHC, IHC-P
NB100-2318
Species: Hu
Applications: WB, IP
NBP1-87224
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PTP4A1 Antibody (NBP1-87224) (0)

There are no publications for PTP4A1 Antibody (NBP1-87224).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTP4A1 Antibody (NBP1-87224) (0)

There are no reviews for PTP4A1 Antibody (NBP1-87224). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTP4A1 Antibody (NBP1-87224) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTP4A1 Products

Bioinformatics Tool for PTP4A1 Antibody (NBP1-87224)

Discover related pathways, diseases and genes to PTP4A1 Antibody (NBP1-87224). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTP4A1 Antibody (NBP1-87224)

Discover more about diseases related to PTP4A1 Antibody (NBP1-87224).
 

Pathways for PTP4A1 Antibody (NBP1-87224)

View related products by pathway.

PTMs for PTP4A1 Antibody (NBP1-87224)

Learn more about PTMs related to PTP4A1 Antibody (NBP1-87224).

Blogs on PTP4A1

There are no specific blogs for PTP4A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTP4A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTP4A1
Entrez