PTP sigma/PTPRS Antibody

Immunocytochemistry/Immunofluorescence: PTP sigma/PTPRS Antibody [NBP2-55570] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.

Product Discontinued

PTP sigma/PTPRS Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KPKVVVTKGAVLGRPTLSVQQTPEGSLLARWEPPAGTAEDQVLGYRLQFGREDSTPLATLEFPPSEDRYTASGVHK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTPRS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PTP sigma/PTPRS Antibody

• EC 3.1.3.48
• protein tyrosine phosphatase PTPsigma
• protein tyrosine phosphatase, receptor type, S
• protein tyrosine phosphatase, receptor type, sigma
• PTP sigma
• PTPR sigma
• PTPRS
• PTPSIGMA
• receptor-type tyrosine-protein phosphatase S
• Receptor-type tyrosine-protein phosphatase sigma
• R-PTP-S
• R-PTP-sigma

Background

The protein encoded by the PTPRS gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an extracellular region, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. The extracellular region of this protein is composed of multiple Ig-like and fibronectin type III-like domains. Studies of the similar gene in mice suggested that this PTP may be involved in cell-cell interaction, primary axonogenesis, and axon guidance during embryogenesis. This PTP has been also implicated in the molecular control of adult nerve repair. Four alternatively spliced transcript variants, which encode distinct proteins, have been reported. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTPRS