Recombinant Human PTP gamma/PTPRG Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PTP gamma/PTPRG Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-102 of Human PTPRG full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRRLLEPCWWILFLKITSSVLHYVVCFPALTEGYVGALHENRHGSAVQIRRRKASGDPYWAYSGKSSCSNGDHTGQLTSHSTHLKAHFESLLCLSSVCSNLS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PTPRG
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PTP gamma/PTPRG Protein

  • EC 3.1.3.48
  • H_RG317H01.1
  • HPTPG
  • protein tyrosine phosphatase, receptor type, G
  • protein tyrosine phosphatase, receptor type, gamma polypeptide
  • Protein-tyrosine phosphatase gamma
  • PTP gamma
  • PTPG
  • PTPGprotein tyrosine phosphatase gamma
  • PTPRG
  • receptor type protein tyrosine phosphatase gamma
  • receptor tyrosine phosphatase gamma
  • receptor-type protein phosphatase gamma
  • receptor-type tyrosine-protein phosphatase gamma
  • RPTPG
  • R-PTP-GAMMA

Background

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. The extracellular region of this PTP contains a carbonic anhydrase-like (CAH) domain, which is also found in the extracellular region of PTPRBETA/ZETA. This gene is located in a chromosomal region that is frequently deleted in renal cell carcinoma and lung carcinoma, thus is thought to be a candidate tumor suppressor gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7475
Species: Hu, Rt
Applications: WB
AF4937
Species: Hu
Applications: WB, IHC
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
AF3697
Species: Hu
Applications: WB
MAB2688
Species: Hu
Applications: WB
NBP1-89062
Species: Hu
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49153
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF904
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
NBP2-42172
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
H00005793-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for PTP gamma/PTPRG Recombinant Protein (H00005793-P01) (0)

There are no publications for PTP gamma/PTPRG Recombinant Protein (H00005793-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTP gamma/PTPRG Recombinant Protein (H00005793-P01) (0)

There are no reviews for PTP gamma/PTPRG Recombinant Protein (H00005793-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTP gamma/PTPRG Recombinant Protein (H00005793-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PTP gamma/PTPRG Products

Bioinformatics Tool for PTP gamma/PTPRG Recombinant Protein (H00005793-P01)

Discover related pathways, diseases and genes to PTP gamma/PTPRG Recombinant Protein (H00005793-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTP gamma/PTPRG Recombinant Protein (H00005793-P01)

Discover more about diseases related to PTP gamma/PTPRG Recombinant Protein (H00005793-P01).
 

Pathways for PTP gamma/PTPRG Recombinant Protein (H00005793-P01)

View related products by pathway.

PTMs for PTP gamma/PTPRG Recombinant Protein (H00005793-P01)

Learn more about PTMs related to PTP gamma/PTPRG Recombinant Protein (H00005793-P01).

Blogs on PTP gamma/PTPRG

There are no specific blogs for PTP gamma/PTPRG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PTP gamma/PTPRG Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPRG
Entrez