PTP beta/zeta/PTPRZ Antibody - Azide and BSA Free

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PTP beta/zeta/PTPRZ Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit PTP beta/zeta/PTPRZ Antibody - Azide and BSA Free (NBP3-03169) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PTP beta/zeta/PTPRZ (NP_001193767.1). VESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTPRZ1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for PTP beta/zeta/PTPRZ Antibody - Azide and BSA Free

• 3F8 CSPG
• HPTPZ
• phosphacan
• protein tyrosine phosphatase, receptor-type, Z polypeptide 1
• PTP beta/zeta
• PTP18
• PTPRZ
• PTPRZ1
• PTPZ
• receptor-type, zeta polypeptide 1
• RPTPB
• RPTPbeta

Background

PTPRB is a member of the protein tyrosine phosphatase (PTP) family. The family comprises at least 37 proteins, characterized by a catalytic phosphatase domain of approximately 240 amino acids, and includes both transmembrane and cytosolic enzymes. PTP1B is a transmembrane PTP. The PTPs have high substrate specificity for phosphotyrosyl proteins, at the primary sequence level sharing little similarity with the protein serine phosphatases, protein threonine phosphatases, or the acid and alkaline phosphatases. PTP beta interacts with and regulates the tyrosine phosphorylation level of catenins, which are critical in physiological and pathological events such as cell migration, adhesion and transformation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: PTPRZ1