PTP alpha/PTPRA Antibody

Images

 
Immunohistochemistry: PTP alpha/PTPRA Antibody [NBP1-89683] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTP alpha/PTPRA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IWEWKSCSIVMLTELEERGQEKCAQYWPSDGLVSYGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTPRA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PTP alpha/PTPRA Protein (NBP1-89683PEP)
Publications
Read Publication using NBP1-89683.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23448979)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PTP alpha/PTPRA Antibody

  • EC 3.1.3.48
  • HEPTP
  • HLPR
  • LRP
  • LRPHPTPalpha
  • protein tyrosine phosphatase, receptor type, A
  • Protein-tyrosine phosphatase alpha
  • PTP alpha
  • PTPAreceptor type, alpha polypeptide
  • PTPase-alpha
  • PTPLCA-related phosphatase
  • PTPRA
  • PTPRL2
  • receptor-type tyrosine-protein phosphatase alpha
  • RPTPA
  • R-PTP-alpha
  • tyrosine phosphatase alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-46466
Species: Hu
Applications: IHC
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NB100-556
Species: Hu
Applications: WB, IP
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF6278
Species: Hu, Mu
Applications: WB
NBP2-42172
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, ICC

Publications for PTP alpha/PTPRA Antibody (NBP1-89683)(1)

Reviews for PTP alpha/PTPRA Antibody (NBP1-89683) (0)

There are no reviews for PTP alpha/PTPRA Antibody (NBP1-89683). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PTP alpha/PTPRA Antibody (NBP1-89683) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTP alpha/PTPRA Products

Bioinformatics Tool for PTP alpha/PTPRA Antibody (NBP1-89683)

Discover related pathways, diseases and genes to PTP alpha/PTPRA Antibody (NBP1-89683). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTP alpha/PTPRA Antibody (NBP1-89683)

Discover more about diseases related to PTP alpha/PTPRA Antibody (NBP1-89683).
 

Pathways for PTP alpha/PTPRA Antibody (NBP1-89683)

View related products by pathway.

PTMs for PTP alpha/PTPRA Antibody (NBP1-89683)

Learn more about PTMs related to PTP alpha/PTPRA Antibody (NBP1-89683).
 

Research Areas for PTP alpha/PTPRA Antibody (NBP1-89683)

Find related products by research area.

Blogs on PTP alpha/PTPRA

There are no specific blogs for PTP alpha/PTPRA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTP alpha/PTPRA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPRA
Entrez