PTOV1 Antibody

Images

 
Western Blot: PTOV1 Antibody [NBP2-13826] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: PTOV1 Antibody [NBP2-13826] - Staining of human cell line HEK 293 shows positivity in nucleus.
Immunohistochemistry-Paraffin: PTOV1 Antibody [NBP2-13826] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Product Discontinued
View other related PTOV1 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-13826
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PTOV1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PPMEGARVFGALGPIGPSSPGLTLGGLAVSEHRLSNKLLAW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTOV1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Publications
Read Publications using
NBP2-13826 in the following applications:

  • IHC
    2 publications
  • WB
    2 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24947166).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PTOV1 Antibody

  • ACID2
  • Activator interaction domain-containing protein 2
  • DKFZp586I111
  • MGC71475
  • prostate tumor overexpressed 1
  • prostate tumor overexpressed gene 1
  • PTOV-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31639
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
H00005956-R02
Species: Hu
NBP1-86881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6008
Species: Hu, Mu, Rt
Applications: WB
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-28884
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13826
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PTOV1 Antibody (NBP2-13826)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(2)
WB
(2)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for PTOV1 Antibody (NBP2-13826) (0)

There are no reviews for PTOV1 Antibody (NBP2-13826). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PTOV1 Antibody (NBP2-13826) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTOV1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTOV1