PTOV1 Antibody


Western Blot: PTOV1 Antibody [NBP2-13826] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: PTOV1 Antibody [NBP2-13826] - Staining of human cell line HEK 293 shows positivity in nucleus.
Immunohistochemistry-Paraffin: PTOV1 Antibody [NBP2-13826] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.

Product Details

Product Discontinued
View other related PTOV1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PTOV1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PPMEGARVFGALGPIGPSSPGLTLGGLAVSEHRLSNKLLAW
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Read Publications using
NBP2-13826 in the following applications:

  • IHC
    2 publications
  • WB
    2 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24947166).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PTOV1 Antibody

  • ACID2
  • Activator interaction domain-containing protein 2
  • DKFZp586I111
  • MGC71475
  • prostate tumor overexpressed 1
  • prostate tumor overexpressed gene 1
  • PTOV-1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PTOV1 Antibody (NBP2-13826)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for PTOV1 Antibody (NBP2-13826) (0)

There are no reviews for PTOV1 Antibody (NBP2-13826). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PTOV1 Antibody (NBP2-13826) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PTOV1 Antibody and receive a gift card or discount.


Gene Symbol PTOV1