PTOV1 Antibody

Product Discontinued

PTOV1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PPMEGARVFGALGPIGPSSPGLTLGGLAVSEHRLSNKLLAW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTOV1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24947166).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PTOV1 Antibody

• ACID2
• Activator interaction domain-containing protein 2
• DKFZp586I111
• MGC71475
• prostate tumor overexpressed 1
• prostate tumor overexpressed gene 1
• PTOV-1

Background

PTOV1 may activate transcription. Required for nuclear translocation of FLOT1. Promotes cell proliferation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PTOV1 Antibody (NBP2-13826)(2)

Publications using NBP2-13826

• Chen SP, Zhang LS, Fu BS et al. Prostate Tumor Overexpressed 1 Is a Novel Prognostic Marker for Hepatocellular Carcinoma Progression and Overall Patient Survival. Medicine (Baltimore) 2015-01-01 [PMID: 25634174] (WB, IF/IHC, Human)
• Lei F, Zhang L, Li X et al. Overexpression of prostate tumor overexpressed 1 correlates with tumor progression and predicts poor prognosis in breast cancer. BMC Cancer 2014-06-19 [PMID: 24947166] (WB, IF/IHC, Human)

Bioinformatics

• Gene Symbol: PTOV1