PTEN2/TPTE Antibody

Images

 
Western Blot: PTEN2/TPTE Antibody [NBP1-58240] - Human Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PTEN2/TPTE Antibody Summary

Immunogen
Synthetic peptides corresponding to TPTE(transmembrane phosphatase with tensin homology) The peptide sequence was selected from the middle region of TPTE. Peptide sequence YFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFST.
Clonality
Polyclonal
Host
Rabbit
Gene
TPTE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TPTE and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PTEN2/TPTE Antibody

  • Cancer/testis antigen 44
  • EC 3.1.3.48
  • PTEN2
  • putative tyrosine-protein phosphatase TPTE
  • tensin, putative protein-tyrosine phosphatase
  • transmembrane phosphatase with tensin homologytensin, putative protein-tyrosine phosphatase, EC 3.1.3.4810CT44PTEN-related tyrosine phosphatase
  • Tumor antigen BJ-HCC-5

Background

TPTE encodes a putative transmembrane tyrosine phosphatase that may be involved in signal transduction pathways of the endocrine or spermatogenetic function of the testis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-57829
Species: Hu
Applications: ICC/IF
MAB2055
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
MAB8967
Species: Hu
Applications: WB, Simple Western, ICC
MAB1489
Species: Hu
Applications: WB
NBP1-32870
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47668
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-87900
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33688
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PTEN2/TPTE Antibody (NBP1-58240) (0)

There are no publications for PTEN2/TPTE Antibody (NBP1-58240).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTEN2/TPTE Antibody (NBP1-58240) (0)

There are no reviews for PTEN2/TPTE Antibody (NBP1-58240). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTEN2/TPTE Antibody (NBP1-58240) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTEN2/TPTE Antibody Products

Related Products by Gene

Bioinformatics Tool for PTEN2/TPTE Antibody (NBP1-58240)

Discover related pathways, diseases and genes to PTEN2/TPTE Antibody (NBP1-58240). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTEN2/TPTE Antibody (NBP1-58240)

Discover more about diseases related to PTEN2/TPTE Antibody (NBP1-58240).
 

Pathways for PTEN2/TPTE Antibody (NBP1-58240)

View related products by pathway.

PTMs for PTEN2/TPTE Antibody (NBP1-58240)

Learn more about PTMs related to PTEN2/TPTE Antibody (NBP1-58240).

Blogs on PTEN2/TPTE

There are no specific blogs for PTEN2/TPTE, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTEN2/TPTE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPTE
Uniprot

Customers Who Bought This Also Bought