PTEN2/TPTE Antibody


Western Blot: PTEN2/TPTE Antibody [NBP1-58240] - Human Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PTEN2/TPTE Antibody Summary

Synthetic peptides corresponding to TPTE(transmembrane phosphatase with tensin homology) The peptide sequence was selected from the middle region of TPTE. Peptide sequence YFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFST.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TPTE and was validated on Western blot.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PTEN2/TPTE Antibody

  • Cancer/testis antigen 44
  • EC
  • PTEN2
  • putative tyrosine-protein phosphatase TPTE
  • tensin, putative protein-tyrosine phosphatase
  • transmembrane phosphatase with tensin homologytensin, putative protein-tyrosine phosphatase, EC tyrosine phosphatase
  • Tumor antigen BJ-HCC-5


TPTE encodes a putative transmembrane tyrosine phosphatase that may be involved in signal transduction pathways of the endocrine or spermatogenetic function of the testis.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Mu, Rt, Pm
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PTEN2/TPTE Antibody (NBP1-58240) (0)

There are no publications for PTEN2/TPTE Antibody (NBP1-58240).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTEN2/TPTE Antibody (NBP1-58240) (0)

There are no reviews for PTEN2/TPTE Antibody (NBP1-58240). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTEN2/TPTE Antibody (NBP1-58240) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PTEN2/TPTE Antibody Products

Related Products by Gene

Bioinformatics Tool for PTEN2/TPTE Antibody (NBP1-58240)

Discover related pathways, diseases and genes to PTEN2/TPTE Antibody (NBP1-58240). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PTEN2/TPTE Antibody (NBP1-58240)

Discover more about diseases related to PTEN2/TPTE Antibody (NBP1-58240).

Pathways for PTEN2/TPTE Antibody (NBP1-58240)

View related products by pathway.

PTMs for PTEN2/TPTE Antibody (NBP1-58240)

Learn more about PTMs related to PTEN2/TPTE Antibody (NBP1-58240).

Blogs on PTEN2/TPTE

There are no specific blogs for PTEN2/TPTE, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our PTEN2/TPTE Antibody and receive a gift card or discount.


Gene Symbol TPTE

Customers Who Bought This Also Bought