PSPC1 Antibody - Azide and BSA Free

Western Blot: PSPC1 Antibody [NBP2-93111] - Analysis of 200ug extracts of A-549 cells using PSPC1 at a dilition of 1:1000.

Immunohistochemistry-Paraffin: PSPC1 Antibody [NBP2-93111] - Immunohistochemistry of paraffin-embedded Human esophageal using PSPC1 Rabbit pAb (NBP2-93111) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Western Blot: PSPC1 Antibody [NBP2-93111] - Analysis of extracts of various cell lines, using PSPC1 at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 10s.

Immunohistochemistry-Paraffin: PSPC1 Antibody [NBP2-93111] - Immunohistochemistry of paraffin-embedded Mouse testis using PSPC1 Rabbit pAb (NBP2-93111) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: PSPC1 Antibody [NBP2-93111] - Immunohistochemistry of paraffin-embedded Rat brain using PSPC1 Rabbit pAb (NBP2-93111) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PSPC1 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PSPC1 (NP_001035879.1). MMLRGNLKQVRIEKNPARLRALESAVGESEPAAAAAMALALAGEPAPPAPAPPEDHPDEEMGFTIDIKSF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSPC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:50-1:200
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for PSPC1 Antibody - Azide and BSA Free

• FLJ33554
• paraspeckle component 1
• paraspeckle protein 1
• PSP1

Background

Regulates, cooperatively with NONO and SFPQ, androgen receptor-mediated gene transcription activity in Sertoli cell line . Binds to poly(A), poly(G) and poly(U) RNA homopolymers

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: PSPC1