PSP/BPIFA2 Antibody - BSA Free

Immunohistochemistry-Paraffin: PSP/BPIFA2 Antibody [NBP1-91704] - Staining of human duodenum shows low expression as expected.

Immunohistochemistry-Paraffin: PSP/BPIFA2 Antibody [NBP1-91704] - Staining of human salivary gland shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PSP/BPIFA2 Antibody [NBP1-91704] - Staining in human salivary gland and duodenum tissues using anti-BPIFA2 antibody. Corresponding BPIFA2 RNA-seq data are presented for the same tissues.

Staining of human salivary gland shows high expression.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PSP/BPIFA2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PSP/BPIFA2 Antibody - BSA Free (NBP1-91704) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQII
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BPIFA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PSP/BPIFA2 Protein (NBP1-91704PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PSP/BPIFA2 Antibody - BSA Free

• bA49G10.1
• BPIFA2
• C20orf70
• chromosome 20 open reading frame 70
• Parotid secretory protein
• PSP
• short palate, lung and nasal epithelium carcinoma associated 2
• short palate, lung and nasal epithelium carcinoma-associated protein 2
• SPLUNC2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BPIFA2