PSMA7 Antibody

Images

 
Immunohistochemistry-Paraffin: PSMA7 Antibody [NBP2-13819] - Staining of human gallbladder shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PSMA7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YITRYIASLKQVGACPLACSPLAAGQSRLRHGGSCHVTSGESE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMA7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PSMA7 Protein (NBP2-13819PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PSMA7 Antibody

  • C6
  • EC 3.4.25.1
  • HSPCMGC3755
  • proteasome (prosome, macropain) subunit, alpha type, 7
  • proteasome subunit alpha 4
  • proteasome subunit alpha type-7
  • Proteasome subunit RC6-1
  • Proteasome subunit XAPC7
  • RC6-1
  • XAPC7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-63270
Species: Hu
Applications: WB, ELISA
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-09016
Species: Hu
MAB8126
Species: Hu
Applications: WB, Simple Western
MAB6529
Species: Hu
Applications: WB, Simple Western
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-31752
Species: Hu
Applications: IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready

Publications for PSMA7 Antibody (NBP2-13819) (0)

There are no publications for PSMA7 Antibody (NBP2-13819).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMA7 Antibody (NBP2-13819) (0)

There are no reviews for PSMA7 Antibody (NBP2-13819). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PSMA7 Antibody (NBP2-13819) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PSMA7 Products

Bioinformatics Tool for PSMA7 Antibody (NBP2-13819)

Discover related pathways, diseases and genes to PSMA7 Antibody (NBP2-13819). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSMA7 Antibody (NBP2-13819)

Discover more about diseases related to PSMA7 Antibody (NBP2-13819).
 

Pathways for PSMA7 Antibody (NBP2-13819)

View related products by pathway.

PTMs for PSMA7 Antibody (NBP2-13819)

Learn more about PTMs related to PSMA7 Antibody (NBP2-13819).
 

Research Areas for PSMA7 Antibody (NBP2-13819)

Find related products by research area.

Blogs on PSMA7

There are no specific blogs for PSMA7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSMA7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMA7