PSMA2 Antibody - BSA Free

Images

 
Western Blot: PSMA2 Antibody [NBP1-54633] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml PSMA2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Western Blot: PSMA2 Antibody [NBP1-54633] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: PSMA2 Antibody [NBP1-54633] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that PSMA2 is expressed in HEK293T.
Western Blot: PSMA2 Antibody [NBP1-54633] - Hela, Antibody Dilution: 1.0 ug/ml PSMA2 is supported by BioGPS gene expression data to be expressed in HeLa.
Western Blot: PSMA2 Antibody [NBP1-54633] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: PSMA2 Antibody [NBP1-54633] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Western Blot: PSMA2 Antibody [NBP1-54633] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: PSMA2 Antibody [NBP1-54633] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: PSMA2 Antibody [NBP1-54633] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: PSMA2 Antibody [NBP1-54633] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Western Blot: PSMA2 Antibody [NBP1-54633] - MCF7, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that PSMA2 is expressed in MCF7.
Western Blot: PSMA2 Antibody [NBP1-54633] - Jurkat, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that PSMA2 is expressed in Jurkat.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Concentration
0.5 mg/ml

Order Details

PSMA2 Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to PSMA2(proteasome (prosome, macropain) subunit, alpha type, 2) The peptide sequence was selected from the N terminal of PSMA2 (NP_002778), Peptide sequence VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV. The peptide sequence for this immunogen was taken from within the described region.
Specificity
This product is specific to Subunit or Isoform: alpha type-2.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMA2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for PSMA2 Antibody - BSA Free

  • HC3
  • HC3;MU;PMSA2;Proteasome subunit alpha type;Proteasome subunit alpha type-2;PSC2
  • MU
  • PMSA2
  • PSC3
  • PSMA2

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA2 is a member of the peptidase T1A family, that is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-49118
Species: Hu
Applications: IHC,  IHC-P
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-56929
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC,  IHC-P, MI, WB
AF4709
Species: Mu
Applications: IP, WB
NBP3-47902
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NB100-74635
Species: Hu
Applications: IHC,  IHC-P, IP, WB (-)
NBP2-30949
Species: Hu
Applications: IHC,  IHC-P
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-62583
Species: Hu
Applications: WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-81555
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-54633
Species: Hu
Applications: WB

Publications for PSMA2 Antibody (NBP1-54633) (0)

There are no publications for PSMA2 Antibody (NBP1-54633).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSMA2 Antibody (NBP1-54633) (0)

There are no reviews for PSMA2 Antibody (NBP1-54633). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PSMA2 Antibody (NBP1-54633) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PSMA2 Products

Research Areas for PSMA2 Antibody (NBP1-54633)

Find related products by research area.

Blogs on PSMA2

There are no specific blogs for PSMA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSMA2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMA2
Entrez
Uniprot