PSMA1 Antibody (1D9-1C7)

Images

 
Western Blot: PSMA1 Antibody (1D9-1C7) [H00005682-M01] - PSMA1 monoclonal antibody (M01), clone 1D9-1C7 Analysis of PSMA1 expression in HeLa.
Immunocytochemistry/ Immunofluorescence: PSMA1 Antibody (1D9-1C7) [H00005682-M01] - Analysis of monoclonal antibody to PSMA1 on HeLa cell. Antibody concentration 60 ug/ml.
Western Blot: PSMA1 Antibody (1D9-1C7) [H00005682-M01] - Analysis of PSMA1 over-expressed 293 cell line, cotransfected with PSMA1 Validated Chimera RNAi ( Cat # H00005682-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Western Blot: PSMA1 Antibody (1D9-1C7) [H00005682-M01] - Analysis of PSMA1 expression in transfected 293T cell line by PSMA1 monoclonal antibody (M01), clone 1D9-1C7.Lane 1: PSMA1 transfected lysate(30.2 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, KD
Clone
1D9-1C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PSMA1 Antibody (1D9-1C7) Summary

Immunogen
PSMA1 (AAH02577, 1 a.a. ~ 263 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH
Specificity
PSMA1 - proteasome (prosome, macropain) subunit, alpha type, 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PSMA1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Knockdown Validated
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, RNAi Validation and ELISA.
Publications
Read Publications using H00005682-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PSMA1 Antibody (1D9-1C7)

  • Macropain Subunit C2
  • P30-33K
  • PROS30
  • Proteasome Component C2
  • Proteasome nu Chain
  • PSC2
  • PSMA1

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

202-IL
Species: Hu
Applications: BA
210-TA
Species: Hu
Applications: BA
DVE00
Species: Hu
Applications: ELISA
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP3-04411
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-24614
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: IHC, IHC-P, WB
NBP1-87345
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87343
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-48909
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF2905
Species: Hu
Applications: ELISA, ICC, WB
AF4779
Species: Hu
Applications: IHC, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-87511
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NB120-10109
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IHC-P, S-ELISA, WB
H00005682-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, KD

Publications for Proteasome 20S C2 Antibody (H00005682-M01)(2)


Showing Publications 1 - 2 of 2.
Publications using H00005682-M01 Applications Species
Ma Q, Geng Y, Xu W et al. The Role of Translationally Controlled Tumor Protein in Tumor Growth and Metastasis of Colon Adenocarcinoma Cells. J Proteome Res. 2009 Aug 11. [PMID: 19621893]
Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018

Reviews for Proteasome 20S C2 Antibody (H00005682-M01) (0)

There are no reviews for Proteasome 20S C2 Antibody (H00005682-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Proteasome 20S C2 Antibody (H00005682-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PSMA1 Products

Bioinformatics Tool for Proteasome 20S C2 Antibody (H00005682-M01)

Discover related pathways, diseases and genes to Proteasome 20S C2 Antibody (H00005682-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome 20S C2 Antibody (H00005682-M01)

Discover more about diseases related to Proteasome 20S C2 Antibody (H00005682-M01).
 

Pathways for Proteasome 20S C2 Antibody (H00005682-M01)

View related products by pathway.

PTMs for Proteasome 20S C2 Antibody (H00005682-M01)

Learn more about PTMs related to Proteasome 20S C2 Antibody (H00005682-M01).
 

Research Areas for Proteasome 20S C2 Antibody (H00005682-M01)

Find related products by research area.

Blogs on PSMA1

There are no specific blogs for PSMA1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSMA1 Antibody (1D9-1C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMA1
Entrez
OMIM
Uniprot