PSENEN/PEN2 Antibody (6J5O4)

Western Blot: PSENEN/PEN2 Antibody (6J5O4) [NBP3-16676] - Western blot analysis of extracts of various cell lines, using PSENEN/PEN2 Rabbit mAb (NBP3-16676) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: PSENEN/PEN2 Antibody (6J5O4) [NBP3-16676] - Confocal imaging of NIH/3T3 cells using PSENEN/PEN2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: PSENEN/PEN2 Antibody (6J5O4) [NBP3-16676] - Confocal imaging of paraffin-embedded Mouse brain using PSENEN/PEN2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clone: 6J5O4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PSENEN/PEN2 Antibody (6J5O4) Summary

• Description: Novus Biologicals Rabbit PSENEN/PEN2 Antibody (6J5O4) (NBP3-16676) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human PSENEN/PEN2 (NP_758844.1). MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PSENEN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PSENEN/PEN2 Antibody (6J5O4)

• gamma-secretase subunit PEN-2
• MSTP064
• PEN-2
• PEN2hematopoietic stem/progenitor cells protein MDS033
• presenilin enhancer 2 homolog (C. elegans)
• Presenilin enhancer protein 2
• PSENEN

Background

Presenilin (PS1/PS2) complexes are responsible for the intramembrane gamma-secretase cleavage of the beta-amyloid precursor protein. Presenilin enhancer 2 (PEN2) is an essential cofactor involved in physically interacting with PS1 and is necessary for gamma-secretase activity. Endogenous PEN2 preferentially interacts with PS1 holoprotein. Down-regulation of PEN2 expression abolishes the endoproteolysis of PS1 and overexpression promotes the production of PS1 fragments.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSENEN