PSD93 Antibody


Western Blot: PSD93 Antibody [NBP2-58558] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: PSD93 Antibody [NBP2-58558] - Staining of human cell line CACO-2 shows localization to plasma membrane. Antibody staining is shown in green.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF

Order Details

PSD93 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ETDETTTKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSQI
Specificity of human PSD93 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PSD93 Recombinant Protein Antigen (NBP2-58558PEP)

Reactivity Notes

Mouse 82%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for PSD93 Antibody

  • Chapsyn-110
  • discs, large homolog 2 (Drosophila)
  • discs, large homolog 2, chapsyn-110 (Drosophila)
  • discs, large homolog 2, chapsyn-110
  • disks large homolog 2
  • DKFZp781D1854
  • DKFZp781E0954
  • FLJ37266
  • MGC131811
  • Postsynaptic density protein PSD-93
  • PSD-93
  • PSD93,110kDa


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Po
Applications: WB, Simple Western, IHC, IHC-P, KO
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA

Publications for PSD93 Antibody (NBP2-58558) (0)

There are no publications for PSD93 Antibody (NBP2-58558).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PSD93 Antibody (NBP2-58558) (0)

There are no reviews for PSD93 Antibody (NBP2-58558). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PSD93 Antibody (NBP2-58558) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PSD93 Antibody (NBP2-58558)

Discover related pathways, diseases and genes to PSD93 Antibody (NBP2-58558). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PSD93 Antibody (NBP2-58558)

Discover more about diseases related to PSD93 Antibody (NBP2-58558).

Pathways for PSD93 Antibody (NBP2-58558)

View related products by pathway.

PTMs for PSD93 Antibody (NBP2-58558)

Learn more about PTMs related to PSD93 Antibody (NBP2-58558).

Research Areas for PSD93 Antibody (NBP2-58558)

Find related products by research area.

Blogs on PSD93

There are no specific blogs for PSD93, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PSD93 Antibody and receive a gift card or discount.


Gene Symbol DLG2