| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ETDETTTKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSQI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DLG2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-58558 | Applications | Species |
|---|---|---|
| Gospodinova KO, Olsen D, Kaas M et al. Loss of SORCS2 is Associated with Neuronal DNA Double-Strand Breaks Cellular and Molecular Neurobiology 2023-01-01 [PMID: 34741697] |
Secondary Antibodies |
Isotype Controls |
Research Areas for PSD93 Antibody (NBP2-58558)Find related products by research area.
|
|
Untangling the contribution of the enteric nervous system to intestinal and extraintestinal disease By Emily Cartwright, PhD What is the ENS?When it's late in the afternoon and you smell a delicious bag of popcorn in the microwave, your mouth begins to water and your stomach starts to grumble. These behaviors ar... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DLG2 |